SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA06807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA06807
Domain Number 1 Region: 357-451
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000315
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Weak hits

Sequence:  281687.CJA06807
Domain Number - Region: 311-348
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000432
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA06807
Sequence length 792
Comment (Caenorhabditis japonica)
Sequence
MDSNAMKLFLAQQKEAQQAQQKEAQQAQEQQFNFFKEQQEQLLRTMLAALTTQKDPTGII
NSLNNRIPTFTYAPEDGETFDKWFGRHENTIKLDGADLDDSAKARFILTKLDKKEAEQFR
NHVLPKTPAEVNFEDTIQMLKKLFNETKSLTRLRYELLSVKFNGYDRKQYTGLVKSRFSA
AQWTKMTEDQAQCLLWIIGLQSNEHLDLRLRALRELELNPSITLSELADRLDQVIALRND
ADFIGGPPTAVHAVNKHAKRQQRYDKGRRHESTKAPTATVPSQSTSSSTPSTPSSSTTSS
SHPCSKCCRIHGRQKCRVSKYTVCRNCNKAGHLARACRQKKTHVSNAIFIAHTSAAKHNR
IYTTVHINGKPIKMQLDTGAEATLLNVKDWERLNKPKLSPSSANLRTTTNAQIKVRGQLN
CKFVLNGHHGSGRCLVTDTVSLLGMDWIAQDNHLYQLLQGRGRYSKARAVAHTEPKDRHP
AHAAIQKVPRSIGQGLPQTTRTPSSTPSSSWRNKTINNCSGRCYDESRRKNKYNIPLDSR
IPEERLRKMEETEREAIEVKKEIHEEADMTAGSSKLSKGKSMDSLNMQVDYRPWYDSEKI
KSAVSRESIANIATSREFFETASTRDWRSGANSRRDSMCSVNIAPLLPPKSDATHLRQAV
VNQSNGRSNGYGHHYSSAEPQNVNVLTISSGYDGNHQNTQKPLHHSHQPPQHPPTSINRL
LQQDSPQTVDPIEQQEVLLMLYLKQNMDIVQDLGIHIPNDLLAEMDDLQMLPVELRICDE
EPHRKEVWMCLR
Download sequence
Identical sequences CJA06807 281687.CJA06807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]