SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA07198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA07198
Domain Number 1 Region: 340-431
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000109
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  281687.CJA07198
Domain Number - Region: 281-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00108
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA07198
Sequence length 643
Comment (Caenorhabditis japonica)
Sequence
MTKAQNQEALTEALAALMTQLASSNELHRQLMEENRALRNAASAAEPPRAIAGGTRASNH
VRLMADLSRRIQKYSYTIGEPDSFMRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTF
HRFVDSQRDVEDIYNVTFKETVAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTN
HIGQVVAGAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMAERKGETITLSQIH
DEWMRFVQIKQQTKIVATSKQNPQAPVEVWKLEARKTKGRENPKFTPKWGSKDRRPAFCD
YCKRAGHHISKCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMI
TLINSKSWKFIGRPPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVREKNTN
LIGMSWLSQSPLMRKAMDVMVNQIEIPSAGMARLKDNPTVRNFSSFSCNHPELDVVNSGC
SPRGVRQGVFGSSPAAHDTSKSDGFGRVNRGNQKMECRSELNEHQSPNSRTFLERKEEVS
SPCKQQLESEVQQDVSRVQPAPNLSQSLRRSQRNRRAPVRYDPCLELQSHSEDRAPKRGS
APYSDRAAARSRGLHIASNCRGKVLGRHVAALVGINVVTYTWK
Download sequence
Identical sequences CJA07198 281687.CJA07198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]