SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA07362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA07362
Domain Number 1 Region: 329-421
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000139
Family Retroviral protease (retropepsin) 0.013
Further Details:      
 
Domain Number 2 Region: 270-312
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000314
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA07362
Sequence length 683
Comment (Caenorhabditis japonica)
Sequence
MDSATLKMFLAQQQEAHKEQLLFLQQQQEKLLETILKKIGTQSDHTNTINSLNGRISTFI
YNSEDGETFDRWYGRYENVIKVDGAQLDDASKARFLVTKLDKHEAEQFRNHILPKMPAEV
NFDETVVMLRKLFNETKSVTRLRYELLSVKFDGYDRKIYTGLVKSRFSVAQWSTMTEDQA
QCLLWIMGLQSHENADLRARALRELEHDSRITLTELMDRLDQVIALRNDADFMGGPSSTI
NAVNINRAKQQHHSTRKPLQAHPKSNNSFQSPNTLCYKCGQMHWARDCKLSSNTVCRNCN
KPGHLTKVCKSKRSVNNTIFISQSSARNRNRIYYDVEIEGKKIRMQLDTGAEVTLMNSKD
WMRLNKPKLSQSKINLHSANNELINVKGQFKCNFTLNGHHGSGLCHVTETESLLGLDWIA
QDTTLYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPEVLNNSKDT
Download sequence
Identical sequences 281687.CJA07362 CJA07362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]