SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA07414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA07414
Domain Number 1 Region: 357-451
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000199
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Weak hits

Sequence:  281687.CJA07414
Domain Number - Region: 311-348
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00262
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA07414
Sequence length 550
Comment (Caenorhabditis japonica)
Sequence
MDSNSMKLFLAQQKEAQQAQQKDAQQAQEQQFKFFKEQQEQLLRTMLAALTTQKDPTGII
NSLNNRIPTFTYAPEDGETFDKWFGRHENTIKLDGADLDDSAKARFILTKLDKKEAEQFR
NHVLPKTPAEVNFEDTIQMLKKLFNETKSLTRLRYELLSVKFNGYDRKQYTGLVKSRFSA
AQWTKMTEDQAQCLLWIIGLQSNEHLDLRLRALRELELNPSITLSELADRLDQIIALRND
ADFIGGPPTAVHAVNKHAKRQQRYDKGRRHESTKAPTATIPSQSTSSSTPSTPSSSTTSS
SHPCSKCCRIHGRQKCRVSKYTVCRNCNKAGHLARACKQKKAHVSNAIFIAHTSAAKHNR
IYTTVHINGKPIKMQLDTGAEATLLNVKDWERLNRPKLSPSSANLRTTTNAQIKVRGQLN
CKFVLNGHHGSGRCLVTDTVSLLGMDWIAQDNHLYQLLQGRGRYSKSRAVAHTIPKDRHP
AHAAIQKVPHKPKRSIGQGLPQTTRTPSSTPSSSWRNKTINNCSGRCYDESRRKNKYNVN
RHVTIPFSTT
Download sequence
Identical sequences 281687.CJA07414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]