SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08172
Domain Number 1 Region: 812-912
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-20
Family Retroviral integrase, catalytic domain 0.0099
Further Details:      
 
Domain Number 2 Region: 494-594
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000195
Family Retroviral protease (retropepsin) 0.024
Further Details:      
 
Domain Number 3 Region: 361-401
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000167
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08172
Sequence length 1347
Comment (Caenorhabditis japonica)
Sequence
MAQLVWRMDSCLPRFTGHSEVKAAHLLELKNAAMVDFNAIAAKMKEASDRALAEITAFGG
QIDRRATSVTNLARVVDQIRHRIEVLEEQQASLMAQLASSQSGITPSNRPISGVGTVSYV
DGAGTSGDNQVQVAKNPTHKDKVSDNTTQSVHQEIDQGNDQEREDEQSPQLREGQVHRVN
VLGFKSTVSIGTYSGAFSESLASFVRQFKDQMRAADAEASDAAQVNAFLTFLVGNARDRA
EVFLNSNPTSNVDQLVTDLKTTFENELTGKLKEAQFSRAENNAVIEKRAREAFLDGLDDS
IRYNVKDKDPKTCKEAFDEAIRQDILREDRRASQQYAPTVALLEEMRSLKQEWINAQSKP
KDNFRSREDNRNKPVRRCYHCDKVGHFIKDCRRRLAGHPKVQQTNAEAVRNHQIHRRPAQ
VNVAATEDLQAQLEVYKQQVAELQRLNGALLAESGAHGVRSLAWPRNNRQEVKGKQNFTV
NSAHIPPMPLTAQIPIKVNGNPCFTLVDTGSTITVASQSFSKRIGIPKLYQASAPHAIGL
GGNAVQMVGAAFVTFSIGSHTVLHRVHFTKGECTPAGPRDYDIILGNDILSQLPQFSIDY
KQATLHIGREIIPIGTRHVTVTPQVFDVKVSEEVVIPACSEKFIRCVKPTTAVVRASVFL
VASQNLLNKSLITAPAVVDPENVCILVTNTSDSDVTLLSRTKAAEQYDITIVHIDGKKNT
VADCISRAKDEIAPLPTEELEDIIEFPVCMAIDRLKDRVPKQFTPASTKKPVDLATEQSK
DKDIGIIKRFLTTTTTPIDGISEKWTPFLERIQLSNTDNASSFTAAAFQQFCNLLDIGHH
RAIPHHSKGNGATERTFRTFHAVMSKYVNKEHTDWDTILPFTTFSYNNTVHSTTGETPFF
MVFGRDPTFTIDRIIDPTPSARKTDIGWFKESLTATLRDVWKQAAVHSREAQANYQKKAN
EGAAGSGIRPGDRVMYRDFSNHKVYNEINVPDLGHLAESYFTFMKTTITVIIIVGVIFLL
TYSIITQTGVTILRSIGKIFAWMLWQPIRGLNYIVQLIANKCRRRRHGHLHIMVILIILT
SANKAQPHPRETTRVFSQDKVSSLTLHLVLPQDNLSYNHSQSELFSSPNLFSLQFRFPPR
NNSSLNLTVLENRTIVKYYALTDMDNNQVEQAMQQVQQLQGHVNTMWKAFDQIQETIYNI
QDMFTATPGASPEGDSKASDKGHEKANDKGHEKAKDKGHEMANDKGHEKKPEKIEWDNHQ
QEGQTRRRPKCIFCGQRTHFSCDCDVEVTLKERLHKADKDLCRKCLALKGYGTHQCRTKK
PCRFCHSNGHHAAFCPKKCGQKSTSGH
Download sequence
Identical sequences CJA08172 281687.CJA08172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]