SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08260
Domain Number 1 Region: 16-79
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 2 Region: 99-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08260
Sequence length 160
Comment (Caenorhabditis japonica)
Sequence
MSAADVQFPIVTRQSDGSKIHEMSGHKFKAALLHQPTFCSYCSKFIFGVGKQGYKCLGCE
TVVHKRCHGQVTARCTFGPSSRTVVTPPESGVRPRSASEEPPSANHHFSRHFYHRPTFCD
HCGSMLYGLTKQGAQCSECHANVHFRCQQKAMRNCGIQVQ
Download sequence
Identical sequences A0A2H2I6L9
281687.CJA08260 CJA08260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]