SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08906
Domain Number 1 Region: 88-194
Classification Level Classification E-value
Superfamily Acid proteases 0.0000143
Family Retroviral protease (retropepsin) 0.063
Further Details:      
 
Domain Number 2 Region: 17-45
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000272
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08906
Sequence length 597
Comment (Caenorhabditis japonica)
Sequence
MVTLNREVRNFSNVLPNYQSFPKVAVQCFKCGGYGHTARICPTLAEAPVQRNALKEPNLK
VESIDIKGLDLQQRKRVKKDVARGTKMIEKGKIGSADVDFVIDSGSRISLMSMKTWRRIL
KINGVEWKKEVRKEKTDLRTVFTAANEPIKLIEKVSVETAMRTRTRRLTFYVAAVDRETI
ILGTEGFKAMGIQLKIDEPPRDVRIVDEVKLDRHGQKMVEIVVEGIIHKERRLCLITPTS
KCLTAGVCQVNSEGKARIKIANHMSESIFLRKGQKIATGELNGFEVLNKRPELLGKLNKW
LRDIEDTKPHKPTVCEVRREVQVGGTRPKGPLKKDGEDAVGNVHSDADSRFGLAHGRKAA
KKNVSKEHAMRTRSFDERNNEAKHEHHVRPANRTFTRPCSCLVRNTFGEKYTKQPVDTLL
VMAPGVSENVTLAFTEKLILKGAQSAEEMLLKQFNKNRYSRMIMIIPFATDNGYMDQWSR
LINVVPGSTKILLIPAPTSINDFSLAGAFISLVASVKRSRGELDVISPGDRVMAHKNQRL
VDLGDQMNSFDYWHVVNNVIRGRNLVWQPLKVIVVDRGQTRRRSEPRQRRQYPHREK
Download sequence
Identical sequences CJA08906 281687.CJA08906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]