SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA09007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA09007
Domain Number 1 Region: 292-445
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-35
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily Acid proteases 7.88e-16
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  281687.CJA09007
Domain Number - Region: 88-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA09007
Sequence length 781
Comment (Caenorhabditis japonica)
Sequence
MTADEWSVFLFFRGLDASGDAAAKIYLMQFTEMAERKGETITLSQIHDEWMRFVQIKQQT
KIVATSKQNPQAPVEVWKLEASKTKRRENPKFTPKWGSKDRRPPFCEYCKRAGHYISKCF
LKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITLINSKSWKFIGR
PPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVRERNTNLIGMSWLSQSPLM
RKAMDVMVNQIEIPSAGMARLKDNPTVRSGNRQQNTKRTRITPSKPCPDTKKPWAHIYVD
FAGPINGFWFLVVEDSKTKYAEVKLTRKASAAATVDLIEEIFTTHGYPDRIISDNGTQLS
SHIFRKMCESHGITHKTTATYCPRSNGAAERFADILKRGIAKIKGSAYINQRVLNNFLIN
YRNTPHAALNGATPAECHFSRKIRTTRSSPMLAERASENTEWTHYQNKMKGVYDKRNGAR
ANTFEVDQKVYARVQHGNKWSWGYGKVRRRVGSVLYEVQIGEKMQRCHANQLRQRHGDKG
PEELFSDSNFPLFSDSMPAQKTNSPKLIQNQRVSEGLRGETNLLRFPDFSSFSCNYPELD
VVNSGRSPRVVGQGVFGSSPAHDTSKSDGFCRVNRGNQKMECRSELNEHQSPNSRTFLER
KEEVSSPCKQQLESEVQQDVSRVQPAPNLSQSLRGSQHNRRAPFRYDPCLELQSHSEDRA
LKRGSAPYSDRAAARSRGLHIASNCRLAPSQGRTKDNFVKGEGGALLIQFLRYLEIGTNI
F
Download sequence
Identical sequences 281687.CJA09007 CJA09007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]