SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10110
Domain Number 1 Region: 1093-1459
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-22
Family Reverse transcriptase 0.026
Further Details:      
 
Domain Number 2 Region: 2235-2402
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.79e-22
Family Retroviral integrase, catalytic domain 0.034
Further Details:      
 
Weak hits

Sequence:  281687.CJA10110
Domain Number - Region: 617-660
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000288
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10110
Sequence length 2668
Comment (Caenorhabditis japonica)
Sequence
MNANTSLAQRLSSAKASYTKTLAFAESLIRAGHKIINDTSATTLETYNGWKAWSKQALDS
MQKMRDIPSAMPELIARHTSPDEEEEAINHLVTHCEEKQMEPKLVTLKTTRLRVLEKIAL
VRPFFELDEVELDEEPSASNGETVQAAAPAHPSAMDSQRTFNALMAPSPPTQSTQADPSR
EVASVEGNIPSSVALRTRCYEDALETARQPERVDALGMLNETSIQEHAANFSTNLGETMA
ADKDLGHSSNDLIRSRVVNDIRDQITQARRVRSTELQAADDSRECGRLREEIDRLRMLLI
SQEDSGQLSRRATPRTAQQENPSRAQFSYPPDGRSDRMDYPCGPIHESYESRLPSAGQYL
SQSPQVAHTWGDNRNSLYQVNPTEAARMIPQFDGTREGYSNFIRIFDAMVGHNAPVHWKL
FVLSTKLTKCTHALSKLDNPTLAYEETRRRLKELFGSTEDSLKLSAELQRANLDRFNPEQ
MRTDLVRIASIVDRMEQSEHGASRGDVFMFINKFPSDIARELTRFFRQGRNTSFRQVWEQ
ANSIVEDLEITQDSSRRIPSNAYSPVPVMAMDETPMDDENIHALYSKKAFPPRKCLFCEK
ACSRFYCQTYYGYDYINRATTAGVCLKCYQRGHKGAQCPSRIVDCRICGATDHTEQGCQV
RAEVIRSHQQQRRTGQPFRRGTGGHVSSNHLSEPHINVVSADKILPLSDPNRQETVDCPS
PHETRASESSEPPLMNNAETRAVSPPPNTHAALDENQQLIHTAELPVTSPTRASDETEEE
EIPGLTLTEFLLESAPEMSVLAYEQPDDTYSLPFLLIPMGDKPPLIALADSGAMCSLFTC
AAAVDRGLPVVATKKTRFNGITGSLTIDAPVYHVQLGDRSNTEIFVKGFPGLNVKIQAPS
FSKEDALALTHHGIDPRMLADLQARHGQLADLIVGQDILPSLYRDTKTFLLPSGRRIEKT
PLGVITHPIPSQKGYQHPDRWVDVRSGATAIDAVIHLIESVDENSITRELDNTYHRFHSL
EVLGITPPSSIRENNLRKEEFMKAVKEKTTYENGRLAVPLLFNGREKELGDNRRLAMSRL
GSSLTKLSKNGLLNVCHDLIQDQLAAGYTPRYRSRSLARLGQYLMTADIEKAFLQVSLQT
PHRNSTRFLWFRDPRKGMKPGNLVTYRFTRIPFGIACSPFLLDVAIRIHLESHPHPVNEK
ILSNLYVDNVLFTTNDREELMSLYEHSKAVFTKCQMNLREYLVNDQETMVNIPSHDQAKS
TSSKLLGYAWDAGTDTMSITIAVLPKSETPTKREIASFLGGTYDPMGLVCPITISTKMLM
QLMWKEGVSWDSPIPKKLLPEWKKIRKAFEDPCYYFPRQLTTRYNYEEVQMLVFCDANDH
NFAACVYLRFSFKDSPPVTNLYLAKTRQKSLNQTSTTPRMELMAIEIGLNAAATLIQEKT
VNVSQIKIFSDSQIALYWILKGDRCHAFVSNRVATINDVVASLSGYNVTFHHVPGSSNPA
DIASRGATLAELKESSLWQHGPDFLKLSPDQWPNSLKKAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXEDELKAIMKELVMPTASTKKKLSKFQTVAINVLTAQTIDAAWKT
EAYTPRVFRRDLAQSYHALARSNTTTSTQLLVAVSDDEFPLHKPGIRYKSFVPYTGTQSM
VKLTTTVGFIMKFLARAFPHQLWKTPLMKTLAQLEILPRTEEGSVRLSLQITARELVRNY
ILKDHYLDDFFSNSGDNPGNFRLRCHRSLAPIRASDGLFHIRRPIEQSHASTSEKFPIFV
INDHPLAKLVARDLHIQNKHASEEQLIRILRKQYSISTDRRLCSHICRTCFHCRRQKARP
YAYPYSSQFPTSRVCPTVPFQNIGIDYAGPIIYRGYPEVELKSYILVVTCLFTRAVHLEL
VPDESALSYLFAMRRVFARRGVPRLILSDNAGCFKLGGYILNGDIRREGPDSRSFSTYMA
EHEIRCQYITPLSPWQGGVYERVVGLTKKLLRTTLGMLQPTYVELETQLVLIEGVLNNRP
ITKNPALNTDRLALRPIDFLLPSVPLATPWAIDEESFQQGTTTEKTTRKFAALLLESIGK
LVDEWSNSYLTGMHKAQLPLGKSQRRIPRVDDVVLVYHEKYARYTWPLGLITKLHPSEDG
AIRSATVRFEGTELKRPVNHLIPLEVPEASNDPAQTGEEATELDRSSFKFRTPLPYEKLA
SVKAKPVPPLGTLPPTSTSINESRKRSKIDSRDPKSASQEQFRARPYLSRLSKSTRIDAV
TLQRVANTAPVVIPAARGRGPPQVLINR
Download sequence
Identical sequences CJA10110 281687.CJA10110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]