SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10177
Domain Number 1 Region: 594-699
Classification Level Classification E-value
Superfamily Acid proteases 0.000000311
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 
Domain Number 2 Region: 539-574
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000227
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10177
Sequence length 855
Comment (Caenorhabditis japonica)
Sequence
MSLRQAEKDVELEVEHVEEKNVVVEVVESVTGGESEERLGAERKVSVRGRRKLVKGFAQW
LKTIEQVSEKVERDLVVLTKCTKRQRDGIIAPLKEFASELLERFEEMGADRWPRSVLRVM
KDFDLENVQEIRQVCEKVFGEACSEANASEDAEKVDKIDRKYQKLKIKLSDCQIMWEVER
ENLLEELESEREKAQKLSESQERFKRKVVKLEKALVAEKQVSEGMKSHLKVWQERSKDDH
ERKQKIHETWRKPRRASRSSTSSSEAPSWENRSETKTDTSRRSEVRDMMDGMRRMMRAQA
LPEPGVFDGEGDFGEFKRAFLLKYNNVTEGPEEMVAILEDKFLKGPAKTLFKTLPNRHNL
SIKSLFEEFERKLRKRQGDSRTKALNEFENLRKSSNQKMWEYLIDVEKWSRKAYPGVDDE
NLSQMRTTKLMMAVKDNENLHNLLIMKRLDYSIEDQTTKVMMAVKDNENLHNLLIMKRLD
YSIEDQYENLKDVVLQQEQEKRQSLKKGHSFLMNEAKMRKDTSWKRSDYHLNQFKNEQKD
EMGFRKEENQSQPDIKCFRCGGIGHMSRQCTSKPAYVVERKKSEESEGVGAEVVETVEIL
GQNRKIIIDSGAVVSVMSSAMWERLKKGCPDWEKRSEELAKPGFTILNASKAEMPVEKQL
KLEVRVRGRKALVVFQLVENSSEVLLLGTNAFKSIGVELKWKAENAGARAGEKLRVPPQS
CSQNEVIVDVDMGKKEWLESNKKWMPARLCSKNDEDMTVSVSNWRNEPVLIKKNQIVGVV
SREWKVYEGKEGKEVNMLDIDKKPSLQGDWRKKEVERLLNENGEIPSGMFRRIISEFSEV
FAIEDSELTQTGMVE
Download sequence
Identical sequences 281687.CJA10177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]