SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10734 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10734
Domain Number 1 Region: 935-1100
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.22e-18
Family Retroviral integrase, catalytic domain 0.03
Further Details:      
 
Domain Number 2 Region: 613-779
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-17
Family Reverse transcriptase 0.01
Further Details:      
 
Domain Number 3 Region: 188-216
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000816
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Weak hits

Sequence:  281687.CJA10734
Domain Number - Region: 223-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00924
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 
Domain Number - Region: 357-394
Classification Level Classification E-value
Superfamily Acid proteases 0.033
Family Retroviral protease (retropepsin) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10734
Sequence length 2180
Comment (Caenorhabditis japonica)
Sequence
MRGSNVTKNFSIRSHLENRDRKNKSVDENSVLGSKRITVCWEDSQNQKTTEIDCQGRRLH
RRPDVEQESLNIFKKEDTAKNNSIEEQRRVLDTTAITVKQLQDLGENLDCQLTKSKVIEK
FNDHIQKEVYKKKLDIPRNEWTTSKILIVLESVVSREEELLTTWKKKKQKEFPEEKDTEK
STKAKLKRQDRPLKCLFCKREGHRARDCRTFSNPQQRKEILIKENRCYICTGIGHQTAEC
KRPLCYNCKGKHHSLICTKPPTTEKRSTEKSPSTETNKQNTKTHALAQTFEVGANDDEDD
SSENTVTVGGQMPTQVEPTLTNCATQMTPTSRTKKRAFIPTVRLDALNPKKNKWESISVM
LDTGADESYVRKSLAQMWNLPHFGTETVNMRSFDSAAAEKTTFGMSTITVRLGKEILNME
VFVSTNLVGHIRKTTLSKADLHHILREGITINDDSLEEEVEPDMIIGDDYLPEFLKGNML
KLPSGVHLMGTKVGHTTWGKPSTRTPTDSRDSTLLENDHLMFTAIHEEDKNSGRQVEELQ
QLDTPMKSEFEHSGPLAEEISEANKETMARFEDTIERREDGYYVRLLYKKDHPKLPDNYS
IALKRLTSVVKNSSKEVLKMIDDVFKDQVEKKVIEEVYTREKGVNMVHYNPHQPVLTPHK
TTKCRVVIDGSSHFRGEPSLNDCIEQGGVLIPDLVDMLLRFRGGKTAIIADVEKAFLQVH
LHEDDRDVTRVLWLHDINLPVTPNNIITYRFSRVLFGLNISPFLLGATILHHLKTIPDQV
FAEEFALDTITEYTNELSAEEVKSAEIILLKDQQRDINTKKLRELSNLGPTLNKDGLLVC
RGRLELADLKEEKKFPVLILPHSNIANQIIWDSHGQYHQSVQHTMDTVRRRFWIPKLRQQ
VKSQLRKCVPCQRMMKLPVRYPDTARLPKQRVQRATPFKNIGLDYFGPISYKKEDESEGS
AHGALFTCFVTRLTHIELVPDKSTTEFLQAFRRFIATRGCPSHIVSDNGTCFVLGQKIID
EATQDEQLPLEIQQFLGIKGIEWKFITAYAPWKGGMYERMVKIAKHAFRKAFIKKVLFYE
ELRTVFHEVAASMNTRPLTYQQEEFDHQLPIRPIDFISQEMSVTLPLVNTLQHSDTYHSP
EELLALKSKHDTIEALTSSVKATEEVWKIWNSKYLAELREQHRKRMDKKRGSLLMPKVGQ
IVLIYDENQPRNFWRMGKVEEVVQGSDGVIRDVKLQVQGGRTISRTINLVVPLELDQEGL
ETENFKEKEAHEEEEAHGEEPKRYNLRQRKKVNYNDDQPDRIGLAITRSVTPILQVMMIM
ALITGINTEPVSVHCTSTGLSLNGQFQDFEACVESYCTSYRRISWTRWTSSHSEVWIPPT
LKLKEHRATVKISDGKHLQIQEVKCPAIPFCQTIDCTFCWTNLLNPECHISFAILGLGAL
IFATLMIFHMMCNVPVTLGAPFKVAWNVSKTILHIIGRLCYSMVEKVTRQRKSRAKWRDI
VVLCTILCLTEQGQGCQEIDILQQIETVCDNTGHCTNFTETAIHLNHVHSEGCIRMGKKG
TTLRDIRIQLMDIEAICTKRTITYTQDIITKVWSTKRCPRMGTCQGDKCKAIKPDSKIPE
LNNVNMMVGNTGCVESCGGPGCGCFLPECRMLNCTLQEKCECQPAEDQMRCTCLDNDIGH
LLQRPTTHLPIRSGYWLLEPFGKAVKGRILTESTVSLTLRMTDIWNTKIVKTEEICQSEN
AIAEGCYSCAPGATAQIHCKSQKEDTMAELECEEESFVIPCSPDGKSTNITFHAAKSQFQ
KNCSIHCGGKRKTHLEVTGVLKYSGSVWTSIYKLIEGNSTIYEEINLPDLGHLLDSYLAF
IKSVLAIIVVAGVIFLLTYSVISNTGSSIIKGLFRGIWILFKLAIYFVIRIPLFIVRTWR
RRSGTHLCMNLCMIFVACLFVQANNLHVKMQIPKNNYLLTEKMRILARGEAFENFMNGLA
QKLLNMNDEEDSVIRDIEKLLNYKSELCGKLHEAELVTSSLRPTSEELDTLQKLERVKDS
FTGHYIRVDFLYSSRRKIYNQIQTTSEAGLWDLEQANKYLDDRGLALQHHQQQEDMTKAR
IQLALGDINRVIVEVKERTRKFLDDIAQTVPEKSMVPDAFTTVLRDMHAAPRTATTAAKS
HTTPASVRYPTSESCNETKN
Download sequence
Identical sequences 281687.CJA10734 CJA10734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]