SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10816
Domain Number 1 Region: 340-433
Classification Level Classification E-value
Superfamily Acid proteases 2.51e-16
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  281687.CJA10816
Domain Number - Region: 280-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000188
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 182-270
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 0.0471
Family HemS/ChuS-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10816
Sequence length 438
Comment (Caenorhabditis japonica)
Sequence
MTKAQNQEALTEALAALMTQLASSNELHRQLMEENRALRDAASAAEPPRATAGGTRASNH
VRLMADLSRRIQKYSYTIGEPDSFRRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTF
HRFVDSQRDVEDIYDVTFKETVAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTN
HIGQVVAGAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMTERKGETITLSQIH
DEWMRFLQIKQQTKIVATSKQNPQTPVELWKLEASKTKRRENPRFTPKWGSKDRRPAFCA
YCKRAGHHISKCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMI
TLMNSKSWKFIGRPPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVRERNTN
LIGMSWLSQSPLMRNAMD
Download sequence
Identical sequences CJA10816 281687.CJA10816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]