SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA11030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA11030
Domain Number 1 Region: 527-546
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000959
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  281687.CJA11030
Domain Number - Region: 574-671
Classification Level Classification E-value
Superfamily Acid proteases 0.000251
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Domain Number - Region: 350-406
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 0.0235
Family Kinase-associated protein B-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA11030
Sequence length 856
Comment (Caenorhabditis japonica)
Sequence
MDEFMETMDGVVEELVVDERRTGTKAAAATTGESTTGTAEEELLREMDMVSLKVMRKRIK
GFAKFVASATEVEQQTREKIVMMTKCSERQKELILAPVAKFGRELLERFEEMGGDEWPRS
VLRVMREFGVESVEELREACGQAARFREQGDSKDKLKKKLENQNNERILLQEAWKEEKKT
LMEQMKKLEEQKKVAEESVERLKKALKEEKKAAEGLKSNLQHCTGEFENVGEENWEQNIQ
EPYRRRGGACGRSKTSSAKEEEGAEGKRIDDYLGESWRGKVEDWEMESRSSRSSGMKEMV
QCMSRMMKSSALPEPKTFDGSGEFGEFKRAFLLKYQEVTEGDDELVAILEEKFLKGAAKT
LFQSLPKRYERSLKALFEEFEKKLRKRQGDRKAEALNEFEELKKKHGQKMWEYLLEVEKW
SRTAFPEVGDETLSQMRTTKLMKAVREDDTLHKMLIMKRLEVPLAQQYEQLKDIVLQQEN
EKFREQGLKKGYGSSSKGNKDPVWKGNRLADPVKESQNKEGGHINFNRKCFRCGGMGHMS
RQCTSKPVQNVKARKEDAVKSVGAEIVEIVEMLGQRRRIVIDSGAVVSVMSTGAWNRLKK
GCPSWEKEVEMLAKPSFTLVDASKMNMPVKEQVKIDIGVRGRRALVVFQLVENEADIFLL
GTNAFESVGVELKWKAERSVAMAAEKLRVPPQSCAQIMVKVEADLGNNVLLESKEEWVPT
SLCSKNENGNLTVLVSNWKDEPLLIKKNHVIGVVTREWELLESKRDKAVNMLDLERKVPL
KGNRRNDEVWRILVENGEVPDGNIRRIVSEFSDVFAIEESELTQTDMVQCEIELDKENPI
RQKCRPVPLALQEKVK
Download sequence
Identical sequences 281687.CJA11030 CJA11030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]