SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA11365 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA11365
Domain Number 1 Region: 628-783
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.64e-40
Family Retroviral integrase, catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 977-1040
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.15e-20
Family Glutaminase 0.0009
Further Details:      
 
Domain Number 3 Region: 1067-1165
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-16
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 329-421
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000148
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 5 Region: 268-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000733
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA11365
Sequence length 1188
Comment (Caenorhabditis japonica)
Sequence
MDSTALKLFLTQQQEAHKEQLVFLQQQQEKLLETILKKIGTQTDHTSILNSLNGRIATFK
YNSEDGETFDRWCGRYEDVIKVDGAQLDDASKTRLLVTKLDKHEAEQFRNHILPKMPAEV
NFEDTVAMLKKLFNETKSLTRLRYELLSVKFDGNDRKIYTGLVKSRFSVAQWSTMTEDQA
QCLLWIMGLQSHEHAELRARALRELEQDSRITLTELTDRLDQVIALRNNADFMGGPASSV
NAINYNKAKQQTQSSRKPSQAHSKSNNSCQPPKTSCYKCGQMHWARDCKLSSNTVCRNCN
KNGHLAKVCKSKRSTNNAIFIAQSSVQNRNRIYYNVEIEEKQIKMQLDTGAEVTLMNSKD
WMRLNKPKLSHSTINLRTANNEPIKVKGQFKCNFKLNGHHGSGLCHVTDTASLLGLDWIA
QDTTLYQHLIQASRWALILLNYDFDIEYINTALFGQADALSRLIATNLANVESEDRVIAS
VEADLDAEHRGIIKNLPVNATTILKASKADPTITAVIKYVRDGNWPKLEKTSPVYQFFNR
RESLSIINDTLMFGHRIVIPKSLRSRVLQTLHQAHPGTDRMKKLARSFVYWPNIDKDIEN
LVRNCVDCQAAAKNPVKTTLEPWPASSSPFERVHIDYAGPINGIYYLVVVDSFSKWPEIL
PTKSITATATIALLIPIFARFGNPKTLVSDNGTQFTASEFATFCASRGIRHLRSPPFHPQ
SNGQAERFVDTFKRALQKMRREGMTQEALQKFLMSYRSTPCSSAPNELSPAENFIGRKMN
TIMDLMIPATHGSRLDREKSMNKMKEQFNRHHGAKKKEFSPGDAVFVKDYRSKVTWIPGH
VVARFGKVKYRVECNGQLWDRHANQLRRRDHQISTSSPLLEMFDLPSQTSHSNPPPICSP
HLPLQHLPQSSPHRQALPNSSPARRLSSNVDRQSKPMDSLSSIDLPSQQMDLSSSDALSL
DDAAMDGSSSDGSTMTRAGPCAPVVGLPAKSGVSGVMIVVVPNVMGICLFSPPLDKLGNS
CRGVSFCKKLISTFNFHNYDCLVHNSNSKTDPRRRDIRERDKLVPVFHVARAGDLPTMRK
LFMQGEDLNISDHDDRTVLHIAATEGYETMIKFLVNVAKVDADKKDRWGRVPLDEARQFN
HTNVAKFLEKAMKRPEQRRHDSVSSLDTDDENFDSDGFPEKPTFSIDG
Download sequence
Identical sequences CJA11365 281687.CJA11365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]