SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA11764 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA11764
Domain Number 1 Region: 298-346
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000686
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 250-294
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000481
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA11764
Sequence length 405
Comment (Caenorhabditis japonica)
Sequence
MAEDIGMEPCFDMEDTKPRKEALKKMKKTERSAPVKEVVENPEIVDDGEEKPMTKTQKRK
LKRKLAIERKEKENEVAAEQGEPEAKKTSQEQENQAENAEKKEKPKHKGKDKEHSFEAIE
KKFSALLGKLSENTANFKEGEAIIKKDVEDGKITTEEAHTLYRVYNRNLRIKRLREKLLK
TLGEGAPLEAVKEKINDWRAAGKVTVTDATLLVKRWKNREMRRVGRQEQKIMCGFSVFLK
FVLCFFFSGSSCFHCREPGHRLADCPKRNNSSSDGVCFKCGSTEHSIHECKKKGVKGFPY
ATCFVCKQIGHISRDCHQNLNGVYPDGGACNVCGAVDHLKRDCPELAAHKAGGAHGFKKQ
FTARAASDWSSQSADADYDPTEGAGNSEAIQKPAPPKKTAKHIKF
Download sequence
Identical sequences CJA11764 281687.CJA11764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]