SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA12261 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA12261
Domain Number 1 Region: 111-150
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000785
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000828
Family Retrovirus zinc finger-like domains 0.0017
Further Details:      
 
Domain Number 3 Region: 55-91
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000419
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA12261
Sequence length 154
Comment (Caenorhabditis japonica)
Sequence
MSDQGCFKCHQQGHFSRNCPTNRDSDGGRGAGRGGSVCYNCNETGHFSRDCTKAGSGGGG
GYRSGGGGGGGSCYNCGGRGHFSRDCPSARSEGGRGGDKFGGGGRSYGGQKCYNCGRNGH
ISRECTESGSAEEKRCYNCQETGHISRDCPTNAN
Download sequence
Identical sequences A0A2H2ICR0
281687.CJA12261 CJA12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]