SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA12566 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA12566
Domain Number 1 Region: 959-992
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000523
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number 2 Region: 1016-1118
Classification Level Classification E-value
Superfamily Acid proteases 0.0000128
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA12566
Sequence length 1234
Comment (Caenorhabditis japonica)
Sequence
MPQENVKEAEKEKTMRTRRGTADTELSAIQNSLDVDDAPYRARLYQLFGLIEKEFDSLYS
ENCACWQRDMVAAPVATFCAELRERFEEVDRDKWQRAVMRMMRENHLENMGMLREACEKA
GRTEGESAEPLKNEILKLNAEKVILQDAWKEENAIIKQELQRLEEEKKTAQEIVDKLKKA
LKEEKKVAEAMKKNLQSVQGELEKRTQLKVNEEFQDNSSKPDAPRRQSRPCSRRGTGDRC
PEGERNENIMRDGSPEWREKIENWEVDIESSSSRDSGVKEWVQTMSRMMKSSAKASTLPT
PKTFDGTGEFSEFKRAFLLKYRNVTDGDDEMVAILEEQFLKGPAKSIFKSLPRRFERPLK
DLFEEFERKLRKRQGDAKAEALNVFEGMQRHSGQKLWEYCIQLEKWSKKAFPEVGAETLS
QMRTTKLMKAVRDDKTLHKLLIVKRLEVSLEEQYEQLKDIVLQHENEESRENEQKKGDRR
GSKGKKEFKWNKRRESWETPSGKGEKEGPETRWKGENQSMELRERFEEVDRDKWQRAVMR
MMRENHLENMGMLREACEKAGRSEGESAEPLKNEILKLNAEKVILQDAWKEENAIIKQEL
QRLEEEKKTAQEIVDKLKKALKEEKKVAEAMKKNLQSVQGELEKRTQMKVNEEFQDNSSK
PGAPGRQSRPCSRRGTGDRCPEGERNENIMRDGSPEWREKIENWEVDIDSSSSRESGVKE
WVQTMSRMMKSSAKASTLPTPKPFDGTGEFSEFKRAFLLKYRNVTDGDDEMVAILVEQFL
KGPAKSIFKSLPRRFERPLKDLFEEFERKLRKRQGDAKAEALNVFEGMQRHSGQKLWEYC
IQLEKWPKKAFPEVGAETLSQMRTTKLMKAVRDDKTLHKLLIVKRLEVSLEEQYEQLKDI
VLQHENEEIRENEQKKGDGRGSKGKKEFKWNKRRESWETPSGKGEKEGPETRWKGEKEGP
ETRWKGENQSMGNRKCYVCGGSGHLARQCTSKPVQEVEAKKEDTEDSVGAETVEMAEILG
QKRRIVIDSGAVVSVMSSGFWERLKKGCQDWEKYVEVLARPGLTLMDASKRQMKVKGQLK
IPIEVRESKAEVIFQLVENQGDIFLLGTNAFRSMGVELKWKAERSMALAAEKLRVPPQSC
AQIVVKVEADLGNSVLLESDEEWMPTSLCSKNENGNLTALVSNWKNEPLLIKKNHRIGVV
TRGWELVVEKQHMVNMMDLDKKEPLKGKNLFSFF
Download sequence
Identical sequences CJA12566 281687.CJA12566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]