SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA13075
Domain Number - Region: 80-106
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00134
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13075
Sequence length 232
Comment (Caenorhabditis japonica)
Sequence
MNIYRTMANANMTPMPFVRKFGSAATTSSDPPPPSSGSRDRETGDKVTLSSLAQSAFPSR
YDPNAFVDVSGQAISAPTVTGACKRCGYPGHLYFQCRNHIQVVPNMSTKAYEVSSTSSES
SDDETPLVELEKQRKKERKQRKKERKERKKAKKMEKKERKRIRKEEKKKRRRQKDSDDSS
SDSSDDDDDDHKKKKKKKKSSKRKRRHSTSSDSDSGSENENDRRDSKRNRRD
Download sequence
Identical sequences CJA13075 281687.CJA13075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]