SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13138
Domain Number 1 Region: 610-718
Classification Level Classification E-value
Superfamily Acid proteases 0.00000225
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number 2 Region: 569-598
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000454
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13138
Sequence length 780
Comment (Caenorhabditis japonica)
Sequence
MEHNESGRMKVEMSLDVMDETQTSVTKGSELSIEERHMSVKQRRKLWKNFARFVDTADNV
EKLVMEKLLSVQRCTERQREMIVGPIEEFRKELWERFEEIGRDKWSRAVLRLMREQDLET
VQELRELCEQGCPEDRSSRRGSGENHQNELIRLKTENERLEARIRECEEEKLRAEKLMRR
AQRAVEKERKTAEELSENLQQATRELGWFWKNGKVSHWKQEQESSETTGNGRRRKEISVA
GSARSEMTGMVECMSRMMKSSALPEPKVFDGTGEFGEFKRAFLLKYGQVTNRDDELVAIL
EDKFLEGAAKSLFKSLPESETTGKRKEKKRRSVWPGSARSEMTGMVECMSRMMKSSALPE
PKVFDGTGEFGEFKRAFLLKYGQVTNRDDELVAILEDKFLEGAAKSLFKSLPERYGRSIT
SLFEELQGKLRKRQGDSKAEALNEFDGLPREKSEEMWEYLIEVEKWSRLAYPEVGEETLS
QMRTTKLMMAARDDDTLHRMLIMKRLEIPLRYQYEQLKDIVLQQENEKRRATRRNYENQI
AREKWWMGKVDERRNTTREEEQKEESEPNQKEISRDRANTKCFRCGGVGHVVRQCTSMPV
QKVSTVEKSKGRTMVEMVEILGQKRRFAIDSGAVVSVISTGAWRRLKRRCLDWKKEVEVL
AKPNFDLCDASKTVMPVTEQIKVKIAIRGRKAVVVFQLVENELDIFLLGTNSFEVIGVDL
KWKAERAVPRTAQNIGERPQSCAQIRAKAKAGLGQLIRMEAEKEVHVSSRDLVPRGYYLF
Download sequence
Identical sequences CJA13138 281687.CJA13138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]