SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13217
Domain Number 1 Region: 497-600
Classification Level Classification E-value
Superfamily Acid proteases 0.000000863
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Weak hits

Sequence:  281687.CJA13217
Domain Number - Region: 452-475
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000733
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13217
Sequence length 744
Comment (Caenorhabditis japonica)
Sequence
MTKCTKRQREGIIAPLKEFASELLERFEEMGADRWPRSVLRVMKDFDLENVQEIRQVCEK
VFGEACSEANESKDAEKVDKIDRKYQKLKSKLGECQIRWEVERENLLEELESEREKAQKL
SESQERLKRKVVKLEKALVAEKQVSEGMKSHLKVWQERSKDDHEGKQKIHETWRKPRRAS
RSSTSSSEAPSWENRSETKTDTSRRSEVRDMMDEMRRMMRAQALPEPCVFHGEGDFGEFK
RAFLLKYNNVTEGPEEMVAILEDKFLKGPAKTLFKTLPNRHNRSIKSLFEEFEQKLRKRQ
GDSRTKALNEFENLRKSPNQKMWEYLIDVEKWSRKAYPGVDEGNLSQMRTTKLMMAVKDN
ENLHNLLIMKRLDYSIEDQLDYSIEDQYEYLKDVVLQQEQEKRQSLKKGHSFLMNEGKMR
KDTSWRRSDRQPKQFKEEQKDEMGLKRVENQSQPNLRCFRCGGVDHTSRQCTSKPAYAVK
EKKSEESEGVGAEVVESVEILGQNRKIVIDSGAVVSVMSSAVWERLKKGCPDWEKRVEVL
AKPGFTILNASKAEMPVEKQLKLEVRVRGRKALVVFQLVENSSEVLLLGTNAFKSIGVEL
KWKAENAVARAAEKLRVPPQSCLQIDLIVEADMGKQMLLESNEEWMPASLCSKNDEGNMT
VWVSNWRNEPLLIKKNQIVGVVSREWKVYERKEGKEVNMLDIQSVDKKPSLKGEWRKKEV
ERLLNENGEIPNPQDSLVVLADMI
Download sequence
Identical sequences CJA13217 281687.CJA13217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]