SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13245
Domain Number 1 Region: 980-1482
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 6.54e-134
Family Molybdenum cofactor-binding domain 0.0000000196
Further Details:      
 
Domain Number 2 Region: 389-535
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 4.97e-39
Family CO dehydrogenase molybdoprotein N-domain-like 0.00011
Further Details:      
 
Domain Number 3 Region: 102-218
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.4e-32
Family CO dehydrogenase ISP C-domain like 0.0000969
Further Details:      
 
Domain Number 4 Region: 513-621
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 3.4e-21
Family Molybdenum cofactor-binding domain 0.0006
Further Details:      
 
Domain Number 5 Region: 9-95
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.71e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00035
Further Details:      
 
Weak hits

Sequence:  281687.CJA13245
Domain Number - Region: 679-703
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000436
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13245
Sequence length 1486
Comment (Caenorhabditis japonica)
Sequence
MSVTATTGIFFNVNGKDVWVDQNLDPELSLAYFLRNKLGLRGTKLGCEEGVCGSCTVVLA
TWDDTCNKAHYRAVNACLVPLFHVHKSFVITVEGVGSRDKIHPIQDRLARGHALQCGFCS
PGFVMSAYALLRNHPNPTIDQINSAIRANLCRCTGYRPILEALYSFSYESSGCCGGKGAG
GSGCCKETRSETEEYEDKLLSFEDFPKYDPTQEIIFPPSLRTWTGSVISGAKSANSVSDT
LLLMSVLNAKLTLLNENDELIQVGIEKFTTEKILWKCTIVNAVFDTNIKRRLFCIKLGES
SEQDSTKFNFAALIGNGNSRIFVGLGGPPKRLEALENHLNRKESYDVVDLTKVSGIDNLA
VITKFSEFLNEIQKKKEPSNINYLQYFKPSQNESVGRPLANYFNERAITGEALYVNDIQA
HEALHLGFVLSTVPHAEILSIDASEALTIPGVVGYFGVEDIPGNNTPGMCKANMNLPDDT
KIFADKKVESVGQVIGVIAANDVVLARRAAKLVKVEYRKLPALLDLQEAIKAESLLGDVQ
HYGKPEDDVKKIIEDSEKILEGEINIGGQEHFYLETQSSLVVPGEGDELIVHCSTQGTSF
TQLMLAECVNLPAHKIIVKTSEVCEILFHWLKTAETSPKLLNKGFAGGKQMDEMTPKTMD
GRGLSGSLQQVTREVERLRRYGRTNQCFRCGGVGHVVRQCTSRPVQKVDTAKKTRKAEMS
EPVESLRQRRRFKVESGSVVSAMSTNGWERSKRRNSTWEKEVEVLAKPNFRGPPHSGAKV
RAKAKAGLRQFIRMETEKQCVPTSLCLKSEDRKVAGMVSNPLSIKRNQGIGVGSRCATRC
SPKAAQVTVDTVDRMSEDKIRWVPREQTRVVSAVQMGAKKGRREARRQAVNCAGESVMSK
FSVENPDLSLTRTLKNRHAGVYTVKPDRDRLSPTSLSASETSDSMECLVDCSDMGVTEHE
TVTNRRLGRSRSGKESRRDTKRLGGGFGGKVNNATWIASMCAVVALKMNRPVYGFLSRSD
DMMITGKRHEVFSKYRVGFDAQGKIKGIHYHAWLNGGWSKDHSEGVTMVMGVMIDSVYNI
PNLHFTGYPVKTNTCSNTAFRGYGNPQGTLVNEGVMRRIAFEVGKEVEVVKRLNFALEGD
RRFMGGKIHSDALIECWDYCYKWSDFELRKQEIKDFNKKSTTIKRGIAMSSVRFSLPHAG
PTAHGIASLLINLDGSVQLSIGGTEMGQGLNQKMLQVCSEALRRPIQSITIVDSSTDKVT
NAPETGGSQNADTNGLAVLVCCKRILSKLQPFIDKNSGDWHKAIREAFANFVPLQCTEYG
MLTPYNTTGACAVIMEIDILTGYNKIIGVDMVMDLGESLNPALDIGQIEGAFMQGYGLVT
CEKISFDPTTGKLDQNSSGKYKIPKAEDVPNDFRVKLLGANKVYGAQVYSSKGVGEPPLM
MSCGAVNSAIMNCVDSWRRENGLVDFVETVSPLTADKIRAMCPIRV
Download sequence
Identical sequences CJA13245 281687.CJA13245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]