SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13459 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13459
Domain Number 1 Region: 471-501
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  281687.CJA13459
Domain Number - Region: 305-360
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 0.0405
Family Kinase-associated protein B-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13459
Sequence length 653
Comment (Caenorhabditis japonica)
Sequence
MDEFMETMDGVLEELVEENRRTDAKAAAGGRTTRGADGRKAWRMTDESTIGTFEEELQSE
DEVMSLKQRRRKIRGFAKFVATATEEMGGDQWTRSVLRVMREFGLETVESLREACEKAVS
GSEVGTSREKLKKEVEKLSNEKTLLQEAWMEEKNMLKEQMEQLEREKNFAEECLSQLKMT
RSVEKKSAEKLERSLQQCSDELEKLRQAKFRRSHKEDLKPRFSQKVDCGNEHLRVKVEDW
EMESRSSRSSGMREMVQCMSRMMKSSALPEPKTFDGSGEFGEFHRAFLLKYQHVTDGDDE
LVAILEEKFLKGAAKTLFQSLPKRYERSLKSLFEEFEKKLRKRQGDTKAEALNEFEELKK
NPGQKMWEYLIEVEKWSRMAFSEVGDETLSQMRTTKLMKAVREDDTLHKMLIMKRFEVQL
AQQYEQLKDIVLQQENEKLREHGQKNGNNKFKERRENDWDKEKRHSDAEEDNRKNEEGLS
KESSTCFRCGSMGHVSRQCASQLVQNVEVEEAEAVKSVGPKTVEMVEILRQKRRIXXXXD
FCQAMQSRSIANLVLFRDPDKTGENHKTGEDKTREDKTGEKIGQNLGXXXXHFVQVAPQV
SPICTFDALYRVCADILVAFGAWWLSTVQAVPTSGGFFVIPDDTSAKGRIRKK
Download sequence
Identical sequences CJA13459 281687.CJA13459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]