SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13466
Domain Number 1 Region: 460-632
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-38
Family Reverse transcriptase 0.0013
Further Details:      
 
Domain Number 2 Region: 329-421
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000158
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 3 Region: 268-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000366
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13466
Sequence length 677
Comment (Caenorhabditis japonica)
Sequence
MDSTALKLFLTQQQEAHKEQLVFLQQQQEKLLETILKKIGTQTDHTSILNSLNGRIATFK
YNSEDGETFDRWFGRYEDVIKVDGAQLDDASKTRLLVTKLDKHEAEQFRNHILPKMPAEV
NFEDTVAMLKKLFNETKSLTRLRYELLSVKFDGNDRKIYTGLVKSRFSVAQWSIMTEDQA
QCLLWIMGLQSHEHAELRARALRELEQDSRITLTELTDRLDQVIALRNDADFMGGPASSV
NAVNYNKAKQQPQSSRKPSQAHSKSNNSCQPPKTSCYKCGQMHWARDCKLSSNTVCRNCN
KNGHLAKVCKSKRSTNNAIFIAQSSVQNRNRIYYNVEIEEKQIKMQLDTGAEVTLMNSKD
WMRLNKPKLSHSTINLRTANNEPIKVKGQFKCNFNLNGHHGSGLCHVTDTASLLGLDWIA
QDKTLYQHLIQASVNSISNAIPEASSACRKKLELGLRSTFPDVFESGLGRCSKAKASLQL
KPNASPTFRKARPVPYAVLPMVTQELNRLVKQGVYTATDYSDFATPIVVVDKKDGSIRLC
GDYSTGLNDSLDSHQHPLPTAEDIFSTLNGGKYFTQIDLSEAYLQIEVDEDSKKMLTINT
HLGLFYPNRLPYGVKSAPAIFQQIVDTMISGLEGVAAYXXXXFGIHCQSEWQTTRIPQKS
LQLKRCQHQRMSLILRS
Download sequence
Identical sequences 281687.CJA13466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]