SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13503
Domain Number 1 Region: 388-423
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000436
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  281687.CJA13503
Domain Number - Region: 10-38
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0837
Family RILP dimerisation region 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13503
Sequence length 434
Comment (Caenorhabditis japonica)
Sequence
MFEFQELHKAERSELKFKVEMLGEELERTRRKLEIAEKAEKCETKKALKMNHGLEPVEME
SDGSEDFEEIRTRIQGCSTKAGRRGSRSTTKPQAKHSKWAPEAYRAGTSKWDLESVEGKR
KVSSWLEENSERRGIEDSVKLRRTQKREEERSEAESWRSRESEKMIKSTMISMSKMMRSS
AMPEPKVFDGMGNLGEFRRTFMMKYKEVVEEDADLVAIVEEKYLQGAAKMLFRSIENRYG
RPIKEVFEEFEQRLRRRHGDSRTHALAEFDGLRRGVNQRMWEYIPEIEKWSRKAYPNLDK
ESLSQMRVTKLMMAVKSDHNLQNLLVMKRRETAPEEQYETLKDIVLQLENERRHDYNQRL
KEHQYAERESWWRKNEAGNDQEVWRMDQKRNGEVGESREDNGNGTKCSNCGGIGHVARQC
TSKIVYRIEKKKYS
Download sequence
Identical sequences 281687.CJA13503 CJA13503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]