SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13676 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13676
Domain Number 1 Region: 527-557
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000171
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Domain Number 2 Region: 576-678
Classification Level Classification E-value
Superfamily Acid proteases 0.00000413
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13676
Sequence length 816
Comment (Caenorhabditis japonica)
Sequence
MEDCCESVLKTNEMAALDPMDGSGTSSTKNSERTSDELLVSVKQRRKLFKNFARFVDAAD
EVEKKVMEKLLSVQMCTERQRDMIVGPIEKFRKELCERFEELGRDKWPRTVLRLMREQNV
ETVEEIRELCERGRREGKSSTSEKLKNYQNNMTVLQTENERLQERIRKCESEKLAAEKRL
RKAQRAFEAEKRTAEGLKANLQHAAGEFEICRVQDEKHQIIQKRSRRASGSPTDSRRSSL
RSRTREQSQGTLEEEESGDDWRRKVNGWDIQREKAVHSEKTESRRIKNAGSLSGSERSEM
KGMVECMSRMMKSSALPEPRCFDGSGDFGELKRTFLLKYGQVTSGDDELVAILEDKFLKG
SAKALFKSLARRYERPIKSLFDEFEMKLRKRQGDSKAEALNEFDGLQREKSKKMWEYLTE
VEKWSKLAYPEVSEETLSQMRTTKLMKAVRDDDTLHRMLIMKRLEIPLRHQYENLKDIVL
QQENEKRRAYGQKKRENAVVRGKPWMDRADERRNNPHKEDRKDEFEPNQRERNRDIANTK
CFRCGAVGHMARQCTSRPVQNVDAEKEAVGAEMVEMVDILGQKRRIVIDSGAVVSVMSTG
AWERLKRKCPEWEEKVEVLAKPNFSLVDASKAKMPVREQIKVEIGIRGRKAVVVFQLVEN
ELDIFLLGTNSFETVGVELKWKAERAVARAARKLRVPPQSCAQIAVRTEADLGDVILLES
EKEWVPTSLCSKNEDGNVTILVSNWKDQPLLIKKNQVIGVGSRDWAMCKPEVAQAAINMM
ELGRKIPLEGARKKEAVLKILKENGEIPEGKIERIV
Download sequence
Identical sequences 281687.CJA13676 CJA13676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]