SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13686 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13686
Domain Number 1 Region: 568-596,638-717
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000129
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13686
Sequence length 800
Comment (Caenorhabditis japonica)
Sequence
MSLKQLFSDRPPLNAVLQEKAQKFRYSCSPSKCLHSLLSFLPIITWLPKYDWSHSFFGDL
SGGLTMAVFSVPQGIALASITGVPPVYGLYTAIFPSFLYIFFGTSKHNALGGFAVLSLMT
HGAIEKVMLRTATSYNATAYVNHTLDELIDMDNDTIITNTTLMQILGNETSFLEEVTMEM
WTEGVTPVKQIHVATTIIFLAGVIQVFMGVFRLQYLTSLFSEQVMSGFVVGGGIHVFFAQ
IGEVLGIRLPRRSGPGYLYYVSLPYYVFSNLKNDFQRISDLIDNLHNVHIPTVSISAFSF
LFLVFGKEYLAPWLSSAFNYPVPFELVLVVVGITATNYAELSRRHDVKVVGNIPTEFPPP
SLPRFDLIRHIGLNAAAIAITAVAIHITVAKVVEKRYKYKINHGQELYALGFVGVLSSFF
PVFPVTSGFARSVVGAAVGGSTQLTCLFSSLALLSVILCIGPALKYLPQCILATMIIFAQ
KGMLEKFGELKALWPVFKIDFVSFRVAIWLMSFLLTVCYDMGEGLLMAIGFAVLTTIIRT
QRPKWHFLSRDDETDHFKETKKRDLERIQGNVCIFRMDAPLIFTSSDRFTMSVWQCVKKW
ERCKSESFVTIEQMNSDSSADIFDSKLKAARRRWKRDQKSDNRCKLVIDCDGFPYVDYLG
LSTLKSVYADLSAAGIQCFFVVQKSELKRLFRATDFYEVVDESKVFSKVVDAVKVAEQLV
SSPKTVKETLTALSSIATTDTTLLDEEEVENQPELVESIAEELENLENTEESMSETSVSI
EEVRSLSRSSSRNSSLNSEE
Download sequence
Identical sequences CJA13686 281687.CJA13686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]