SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13818 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA13818
Domain Number - Region: 106-133
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00238
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13818
Sequence length 258
Comment (Caenorhabditis japonica)
Sequence
MISHLLPLMEFLADASHVQEGADGTRTETAFTEVDGVRFKVVTQFKVINKRVPKVVADRK
RWVKFGSCKGEPAGPQVATTYVAEEVEMQFTRNRAGEQILDVQEDKQTAKTTSREHCRHC
KGNDHWSTHCPYKVMYQLDEEADAEKDADKGVGALGLRGDGRQMDRNRQVRREHVPCHKL
AAGDERRRVARTVRQNGTHYENLHRPRQDHWITKGIRVCDVRIEGRCCPCHRQTQRHPNA
SHGVEGRMDSSKQLNFSI
Download sequence
Identical sequences 281687.CJA13818 CJA13818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]