SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14040
Domain Number 1 Region: 421-452
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000994
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Domain Number 2 Region: 585-637
Classification Level Classification E-value
Superfamily Acid proteases 0.0000901
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14040
Sequence length 814
Comment (Caenorhabditis japonica)
Sequence
MDLFIGEKRQKKTFFFLFIDVKKRQTMSKIRLPFGPIFVRPVRPFVRPSAVRPLRPRFVR
FVRGRIDKSLAAAAFPGETSDIRKASAVARSKETGTEQSDPVTERDAQQPSVCVITQTDA
KEAATSERARGTRRSTSQTSRISRSTSQTRRITRALSASQQPRINVFAMKSAATVPIFSG
TNKENFHAFVRNFKDHVRLTNEPDDKEVRNHLLTVLTDFARDTAEEVLDRNPDATSEDII
DALRAQYEDQYSTQNRLDAIKACFQYAQEPVQDYYQRIRKLMREAQTGANRAEVTQASKE
AFRNGLQSEILRFYVTTARSTEFDQVYRDAIFYEKALQEKERKDRADAAAIASRPRTAEV
FAHAAVRNQEQYFDYDNERNYYPAVAAFNQPPGSPGAMNNSPFDHGYNRNRNINANRDFG
RSFEQVQNRNAECWYCGRPGHYRQDCRKRAADIARGIYRSHMRTPHNMAPHPSRSRNAES
RRPPLNPVENHRQPTVRVIQTSEPHDQSTSTVLQDAQARINQQERMIKMQENQLNDIRWR
LEAYQMGRSPGNSPPPSVNLATPTDPTPTVATVRQVSTLPITAQIPIRANGIPCYALIDT
GSSITVTSENSKDTFCSTPLEPPQSSTALGLGGTSGRTADEFRPLFFRPNGSPKFGEDHR
KPCRMDTDETQGIAIKALRNFTMRLFLSWEVHISNEKLVFRVTNGKEIVINTWRLFHGCA
EYKIPMTPYPEFRERLEDLGFADDLLDEPKTPEQVLALRRFSSPKLGSWRQEMGKKHIYF
SFVNYSTKSFEEDREWVATYVVLKIRNETYQDVF
Download sequence
Identical sequences 281687.CJA14040 CJA14040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]