SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14080 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14080
Domain Number 1 Region: 12-45
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000014
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Domain Number 2 Region: 87-194
Classification Level Classification E-value
Superfamily Acid proteases 0.0000294
Family Retroviral protease (retropepsin) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14080
Sequence length 600
Comment (Caenorhabditis japonica)
Sequence
MVTVNREVRNFSNVLPHRQGFPKVAVQCFKCGVYGHTARICPTLAEAPVQRNALKEPNLK
VESIDLKSSDVQQGKRVKKDVVRGTKMIEKGKIGAADVDFVIDSGSCISLMSMKTWRRIL
KINGVEWKKTVRKEKTDLRTVFTAANEPIKLIEKVSVETAMRTRTRRLTFYVAAVDRETI
ILGTGAFKAMGVQLKIDEPSRDVRIVDEVKLDIHGQKIVEIVVEGITHKERRLCLITPTS
RCLTAGVCQVNSKGRSRIKIANHMSESIFLRKGQKIATGELNGFEVLNKRPELLGKLNKW
LRDTEDTKAHKPTVCEIRQEVQVGGRHPKGPLEKDGEDAVGNVHSDADSRFGLAHEIKGR
KAAKKNVGKEHEMCTRRFEEKNYEAKREHHVRPANRTFTRPRSCLVRNTFGEKYTNQPVD
TLLVMAPGVSENVTLAFTEKLILKRSQSAEEMLLMQFKKKRYSRMIMIIPFGTDNGYVDQ
WSRLIKVVPGSTKILLIPAPTSINDVSLAGAFISLVASVKRSRGELDVIYPGDRVMAHKN
QRLVDLGDQINSFDYWHAVNNVIRVRNLVWQPLKVIVVDMGQTRRRSELRQRRQYPHREK
Download sequence
Identical sequences 281687.CJA14080 CJA14080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]