SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14084 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14084
Domain Number 1 Region: 169-204
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000128
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 
Weak hits

Sequence:  281687.CJA14084
Domain Number - Region: 56-100
Classification Level Classification E-value
Superfamily L30e-like 0.0541
Family L30e/L7ae ribosomal proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14084
Sequence length 205
Comment (Caenorhabditis japonica)
Sequence
MTSEKSSLSLAVVDHGDRSHSRREKKLGMLESAQKKKKKFEEEKAPKVTGKGIQKSLDFN
TNLKNLLRKAVHDGEFMEPGKEVLALLSNRNAELVLLDHDPGILAAKEKIDALKALTSES
TGSTSAPDMASLLLFYQLSGNQRSQTDSRKRRIDTKDLQWFRGTDSFRGNGRVRDHQSQR
KGRADVKCLRCHRFGHYANRCPQKR
Download sequence
Identical sequences CJA14084 281687.CJA14084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]