SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14117 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14117
Domain Number 1 Region: 31-73
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000183
Family Chaperone J-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 410-515
Classification Level Classification E-value
Superfamily Acid proteases 0.00000193
Family Retroviral protease (retropepsin) 0.043
Further Details:      
 
Domain Number 3 Region: 367-394
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000244
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14117
Sequence length 1004
Comment (Caenorhabditis japonica)
Sequence
MRSAVGAPILFVLFVAFLAPKCESVGFAPELYCGLENCYDVLKVNREEFDKQKLAKAYRS
LARKHHPDRVRNKKPVSTGYKKPVSTDVKKTGFRRFLPVSTGENRCFVCKHSDAQLRTKI
VFFLILNVQILLAFLFLSFFSSNNKEYRITLVGSKDVAISRNTEAPKKNKPLVQFAPAPA
DALAAFAFVPPSGTLIITVSVCFETPLKKRPIKLLFSEFEERLRRRQGDSQAHALAEFDE
LQKEVNQRMWEYLPEIEKWSQRAYPNIDSETLSQMRVTKLMKAVKEDQNLQNLLIMKRRE
TPLADQYETLKDIVLQQENERWRDADQRQRTLKGTEERIETEWKSREEDMGQGQEQRGLQ
SLSESSQGTEESSKRRKCFRCGGAGHIAKECTSKPLYNVVREAESVGTEMLETCEVLGQK
RKVIIDSGAVVSVISSEAWKRLKRGCKGWKYKCEMMGKPKCTLVNAAKLSMPVLDQVRLE
IWIRGRKAAVVFQIVQNETEVFLLGTNAFKTVGVELKWKAEKLENRGWRNKWQRSFVVKA
NRGLRGAKKEYAVNIVRPAEKKKRVNVENGNSFKRRCWSVDKPVVAMMLKKTERAKDNGM
MLKPDESRKRSGEAHGKMALGWTAGACNGRRKRGGQSLTCGRLPATEKLEESIKEAGCSL
IYETKTKTPQMTSSTITLIRKLWKIQEKSERNLKILKTRTITFVRLDLADQITKIHSFFF
FFVFFLLFMNSDLVHWGMRRETRKSSFYNYYQYYRLRAAPKVDGRLVVIGTILVISLFQY
LSAKHKFSEAIEYATGVGKFRNMAIKDGIDKGLLEMDRNGKLKKIKGQDNDAIIKQIIID
NLDFRKVETLTNPGKTTNPGKTKPGKTKPGKKSDKTWEEAPPPFAAAARCFVLEVLKKCA
ADLISFMEEKISQNGLGSASARSKRFTVAARCFVLEVLKKQEKRFTDADIDDMFERECWL
KSNCATWKAERDAEEQEKMAQSGKYKRYKRYMKNAGTISFVDED
Download sequence
Identical sequences CJA14117 281687.CJA14117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]