SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14348
Domain Number 1 Region: 141-310
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.12e-39
Family Reverse transcriptase 0.011
Further Details:      
 
Domain Number 2 Region: 1059-1219
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.03e-37
Family Reverse transcriptase 0.00049
Further Details:      
 
Domain Number 3 Region: 938-1029
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000528
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Domain Number 4 Region: 869-913
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000356
Family Retrovirus zinc finger-like domains 0.0021
Further Details:      
 
Domain Number 5 Region: 458-517
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000163
Family Retroviral integrase, catalytic domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14348
Sequence length 1248
Comment (Caenorhabditis japonica)
Sequence
MVPAPSPYRHHSRITAYWATIQTLLIHAGLPVTHPSLLADSTSSWHVEGKDLEDKSKVSL
LMSKMSDEVYEQYSKRICPRKHTEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDET
PVEYTTKVNSMCESAMLQDIDAEGWKVIKNMCEPKDQKTLRSFMGMVTYYSAFIPKMKTL
RGPLDKLLMKDAEWRWTKVEAESFQKLKDVLSSDLNLTHCMPKIPIVVAADACDYGIGAV
ISHRFADGTEKPIAHAARSLNSAEKNYSQIEKEGLGLIFAVKRFHKYLFGRKFLLRTDHK
PLLSNFGSKKGIPVHSQNRLEDVEEVLYAAVRKLPIRVKDIQEETWKSNTLKEVINCVSR
NSWPKKPEGKLKQFFDIRSVLSVVQNCLMFKERVVIPEALQKATLRQLHEGHPGIVRMKQ
LARSFVYWPRMDSDIEKLVAACTTCQIHGKTTRKVPLEPWTTPDRVWQRIHIDYAGPDNG
QYYLVVVDAKSKWAEVAIVKSISSVSTVRKLKKFMLRMMRMFEKQNEQHQAAMTALVQAM
TSKSNDESRADMTPTTSGVSQTQLMNDIGSRVAMFQFDLETEKTFSKWYARHEAAFTKTK
SFMLRMMQMFEKQNEQHQAAMTALVQAMTSKSNDESRADMTPTSSGVSQTQLMNDIGSRV
AMFQFDLETEKTFSKWYARHEAAFTVEGKDLEDKSKVSLLMSKMSDEVYEQYSKRICPRK
HTEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDETPVEYTTKVNSMCESAMLQDID
AEGWKVFFWLKGLDASRDKSARTYFIRYVEQKWEKKESVNVNDLCEEWKKLLRQNSVVQE
MEQVDKAVRAVHTRKDFNRNHKKLWNREQSSGKVDECWNCGKVGHRKPDCVQRLTKCFKC
QKTGHLSKYCKSKGSKKAQSMVVIESAAAEDVEVNALRQYVMVEVNDQLIEFQLDTGSDI
TLISRKDWMKVGEPELEKCPMKVKSASGNEVKLLGRAKVDFMLKGSAASAFVHVREHGNL
LGLDWISKSSEMTYHMNMMVNELESSDTESIGKELKEKFPEVFLEGLGTCTKEKAVLTVK
DKSSPAFIGKRPVPYGALETVEQELDRLESLGVLKKVNHSLWAAPLVCVKKKDTGALRIC
ADFKTGLNAALEDEDHPIPTPEDVFATLNGGTVFSTVDLKDAYFQIELAEESKPLLTVNT
HRGLYQYQRLPFGAKTAPMGKKKPKNPFFPGVIRIPIVYKPSSVKNYF
Download sequence
Identical sequences 281687.CJA14348 CJA14348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]