SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14711 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14711
Domain Number 1 Region: 1081-1233
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-37
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 1687-2166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-27
Family Tandem AAA-ATPase domain 0.024
Further Details:      
 
Domain Number 3 Region: 826-915
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000000111
Family Reverse transcriptase 0.0067
Further Details:      
 
Domain Number 4 Region: 595-697
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000015
Family Retroviral protease (retropepsin) 0.017
Further Details:      
 
Domain Number 5 Region: 453-495
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000667
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14711
Sequence length 2260
Comment (Caenorhabditis japonica)
Sequence
MDDIAQPPIVSHAAGQMFSDFVVPSSPRLNTASGFPIRRFVEIDIVMEHQDTEPFVIHTA
VAARISVSTSVTGVHLSTLKKAIVADFTLRDASFVKLKDTVGQLQDAGKDRSDVAVQLDD
IRAALSNAEVYYGQLVNRINDLEKQVSNSPAALANGPRKGTTTQEGGENGQGNFTRSSNH
IADPREDSSLSNISKSHSLSEQADVFKSADALDISDVSGIASQAGAGPESGDELSGDVLN
VSGMDTIPAPVIGVLGIKHALPLKPFTGNISDNYPQFIRTFGDYLDASCDDNVTENQKIK
GFLTFLTGRARNKAEEVMKKKDIKSLKELQDELATVFDNDILSDHREEVLRNCKQAQDET
VDQFYQRIESLENLINSGKTNPETVQRIALQAFVNGLGWHIRFNVKNKRPRTMDAAFQEA
IFQETLHKEQVGSQVFSPLALAYLANYTNGAQTSGQDRQNRPQPDSTRFRGECFYCRKLG
HFAKDCKKKQRDQGSRRNVNYRPKDPVANHRQWTPKPAVQTNAVHTGMPTYEDLARRLET
KDAQIEQLCAKLSEMQGDDYESTFDSKVCSLTWPGSSNIPKQATQAAHGEYFTAHVPIRA
NNIPDSALIDTGANLTVASADTCKMLGIQQLQKSRAPHAIGLGGNAVKMAGSATVTFRIG
SNTMDHVVHFTPGKCIPEEGRPYSFIFGNDLLAKLPPFFINYKEAVFHVGDDVLPMGRKV
GNMKLTRNFQVQVCSDTVIPAGTEALVKCSISPIPKKEDNLVLMVDSQLLTKEDLFVSPA
VFDSNNVLLRIGNPTIEDKQLNANQTAASAERITSQGIQKAELQALLDEFADTFSKNAYD
LGSSKTEPVHIYTTTETPVRGRSYRVPVKFQAELQKHIHSLLWSERITESNTPWTSPIVV
GKKKNGSMRVCLDFQLEDIIDFPVCMVVRAKKHVSNYFTPTGSNTPINIIDEQEKDEAIR
TIKNFLANPAAPIDTIPKSWDPHLEKVRLSENGTLTVAYPDGFYKTIIPPQLTKLVFDYY
HGDLAAGGHFNPRKTQTKILRNYFWPGMSHDIVKWTRECVKCQQKRNPHPSTRTPQEIVL
TSHVFEKIGVDLTGPLRTTPTGNKYYMNIVCWFTKFVISVPLPDSKAETVARAILNECLL
KFGCPGEIVSDNAKTFTAEAFKQFCELLRVSHHLAIPYHSRGNGATERTFRTFHSLMSKY
VNEAHTDWDTILPYITFCYNTTIHSTTGETPFFLLFGRDPVFTIDRILDPTPSSSNQVEI
SFWTHHIVATLRDAWREAAVHSKKAQEIFQRKANIGALGSEIKIGDRVMTINRKDKKDHS
RKLRLPWAGEFRVVDIDSPKATILDLQDPKHSTKSGPTDARSAARRLHVKPEELLNDSRR
PYWFIARYRTVERVLSAPQPFMELGRDYDITKKKRVVANGLMRPVLIRTQQLIPLQRNPG
MVVALLPQLMPLQLARGIRPGHHRQRVMRLTAALSQGWMVHPVAKEVLPWKDSRHEMLRA
APQLCAAFQHDNTSWQAVRFMASYGVYAQIAIEAIHYDYWHYTTTITRVTQGDRCVLATF
AIAREGQQVTLGNWKKHTQATMELPDGRALQIAIEFAVSEGFGARITARMMTLQANDPLI
GTLEQQTVTVYQNTEVKEHMVLHIPKGKQLPSTESSAALSAYAAINGGNRIEMDVVQSNE
ERIKVGNFTLSKQQSDIAYAINSKEYRALALDCGFGVGKTLTAIVAAVSRVRENPSNIVI
FTGSSNAVATAAVGKAAEVDPQLRFVRIISQVHRNRVEEELRTEFDFPVLWRRIFERIFT
DHNVPGMHVSAINMQAIRLYLNHTQDQRIANSVIKRGLLPKNIDAAEELTLWECFYRIYQ
PRILMGTTTAILSSARSAELDARKDLVDLVMIDEASQLPLASFAALATTFTKAKMVLIGD
RHQLPPYADRALPQLLKKASIGTPLSDAIDNRAIPSLPLTEVRRCPQQITNLLGALFYDG
SLKSTRTDREINIFFSAVGLPDDQSIAFINNESRHTQSGPTLINEGEAALASKLATRLKQ
VFPSVSIGLLTFYSGQHGLLASRLVNQAFVSTIDGVQGKEFDITIVCFTRSTGYRNSQFL
DDRHRITVAISRTKKACFGQGQVQQVQLVFTFNYLFLLLLRRTSYKYLLSVRQNDQTQSA
EEFMRRKRQSEAPEESAIRKKKDQKSRRLRRAVSTQKEKMMERISKSQSKLETRLSETKE
RAEERRSSLQSIAKAKRASETKEQSTERITHHSTRYRKKG
Download sequence
Identical sequences CJA14711 281687.CJA14711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]