SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA14895
Domain Number - Region: 791-819
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00015
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14895
Sequence length 1282
Comment (Caenorhabditis japonica)
Sequence
MVRKSQRPIGKSSAAPFPGETSDIRKASAVARSKETVTKQSDPVTERDAQQPSVCVITQT
DAKEAATSEKTRGTRRSTSQTSRIIRSTSQASRITRSTSQTSRITRYTSQTSRITRYTSQ
TSRITRAMSASQQPPINVLVMKSAATSLTTKRLHIRIHIRRHHQRHQGMLSISLEVRHSI
RKNKICFLDKMTRRRQHSFTENATNSTAEALEDPNKSEIDRYRTVHTTKSVATDLSSRQV
HRDKPRRIAIQCAENTKETRHRFFEFIYPRIFKTMVYRLHTDRTDRSKAPMSPPTRKKKP
MPPAPDENEKLSVLPGLRTDPAPGDGLERAAEGPNKPESGGPAPPPAVSAAESAISSTPS
TLSVSTPICQTGLPPELYSSTSTAADDKMEVVSKTSWQPEDDIEVDVSEQEEEEGMTPES
EDERPNPAHEAEPDFPLPVTSDELQVPAIQQHHPFHVLYAPSENEGPPKDVAKRLVSTVL
LSQVHDFRMKTLNWFDPIEKCAPPVLAPEDQAVEQVVSLPATPFALYVVHVHQVSSATLL
PVHRELAADDRPDLIYVNFQPRYARESTTGGAHSAEKFFPGDLLAVTRLGRLPNTTSDHF
IRSQDGALLTENHNFWTVVDYTLIKRAVRAHTVSFHPRKHQDINRHHIFALEIPGPINVP
PNLSSSGQQLLPGRFYRTTMFVPQVHPSSILHNVLSEAARRQVLRNTSPFAFSHTYLPTL
ISANILTVRSSQFPNITNNLQDLAHVSSTDAMDSLFLVGRLAISTAFALTHNTTKNNHNF
SSRPNANCNYSKSRSYNAECWYCGLSGHYRQNCRKRATDIARGIYRSNMCTPHNVPPAPV
PQRKPRTTTTLNESRGEPPATRKSARRAVRASNTDAMETMTPTPTHRKQATSEPSQPEPI
RATTQPSEAFGNGRERPTRSRQTGTKATTSSSSRIRVDPEKKGGGVMSGLAQAYILPGTH
VTSPPCLSYLSISLDHPASLWSPRTSRRLSRNSCASLVNATSRLWSHTTWTLSLSLSDLN
ISRLFVARESAHEKAKHRPRLSQFSALSRRQRGRVHHCAKGVRLQRSVLRIPIYVYFCLE
MSDKIGKRLDKIVKFDFSKNLTDSVREDTAVKLCGQFLEQLTSVIENTEITENVEEDEEE
IEDDFEIMDTMENYLQDKKMATIFSQRNLQCNAVLPYTSTIPVTEWEKRDISIVASFGFP
RIVPKYLRSRARSKAILVLIHQHIHKMFPANKVSDIAYSDKNANVPYLVFCVDDVSVIVR
ISIKPFSGPTFLSRNVIDIYER
Download sequence
Identical sequences CJA14895 281687.CJA14895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]