SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15255 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15255
Domain Number 1 Region: 1197-1548
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-93
Family Reverse transcriptase 0.00013
Further Details:      
 
Domain Number 2 Region: 114-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000942
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15255
Sequence length 1752
Comment (Caenorhabditis japonica)
Sequence
MQAVGGQDEEDVRGPKQSRNGKATTSPMPPARRRISGRLQHPRSDFVQEKAKESFIDGLL
FNLKFHVKGESPSSFQEAQNSAMKFEMLLAEAARANTILPQGLAVMPAPAPTHQPKKAKG
ECFYCGIPGHFANECRRRVKDRANGIFRRENKTGFNPRSQTGFNPRSQTRSFPQNNPITN
HQIFANQPTVQTIQSAVPALHAQMDALKAELEVRQNQINALIRRNDELAGSAPVTQSSNA
RVSCFRWSQTCLLTFLTLGSLLTPAFAVDPLVCMPHSPQNYIRLPAPLDCSKASSPEPHP
VVYKELTIYRPNTIAYESNGTLCKIVKRVTKYSVNMFGVRSEESTVKQLTVSSEECQNMK
KFLHCNHGDLVPVNGIYKTLNDHVINWPSAPFSVFLGTQVTESTNCFLLNTRVTTRFGKE
TPESPAGSMAGCRFTSGFCNTREGAAFQWTPNPRQECKYLELKTMKGYMTNNIWLSKEKE
FAISFDRNSTKLIDCGRKLTISDQGYGVSMATRNKRASTVDELTNFVPSNQLAAQLLAVE
EAVLETTAAWFANNFMSWCSSFNAITAATHAATASNPTLAARQLLKKETSLPGTSVATFS
HSRYVHRFPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLGK
PADQSIFPSRIAVHVLKDTIIPPLSESFVDCVLPVHNAPQDLVLISQSNTLTGQDLIIAP
AVFTSKNAKILVTNPTNEAKILTPDAAQQPEEQDPEFKVDLAQAVVSDEERKQLESLLEE
YHDVFSKNAYDLGRSKTDPVHIYTNTEIPVRARPYRVPVKYQAELEKHINSLIRSARITE
SNTPWTSPIVLVKKKNGSLRRALKTVLCGLEDEALVYIDDILVYSRTFENHLSSIRKVLD
RFRNFNLKASPMKCEFAKSSITFLGHEISKDSYSPNKANVAVIAAFPIPTNVSEVKRFVG
MAGFFRRFIQNFSEIAEPLTRLTRKDKKFSWNKDQQEAFEKLRKLLILEPILGFPDYDKP
FHIFCDASAVAQGAALMQTRPDNEKEYYSVAYASRTLSDTETRWPAIQVEMGAIIFALRQ
FKPYICMPKIILHSDHKPLTFLLQKSKTHDNIARWLVELQSYDINIIHIDGKKNTVADCL
SRARDEENPGDQAELRDIVDFPICMNFSPALLSLARRNVPTTTLDIASEQEKDVQIRAIK
KVLMNIAEVSSLSEEQKDRYALSSITPNGTVMTRTTPESGHFNWKKTKAKIERKYFWPNM
NKEILDRCKSCEKCQAKNSPVPAYRERLLTVVTSRVFQKVGLDLTGPLRTTEGGNKYIVC
ISSTSYVGFPSS
Download sequence
Identical sequences 281687.CJA15255 CJA15255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]