SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15285 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15285
Domain Number 1 Region: 130-171,239-319
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-18
Family Voltage-gated potassium channels 0.0074
Further Details:      
 
Domain Number 2 Region: 278-423
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-17
Family Voltage-gated potassium channels 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15285
Sequence length 540
Comment (Caenorhabditis japonica)
Sequence
MENSLDTVHRKHSSTANSITLPRSPKLTNLQRSVSQDCDSPSTPKHRVTIKNIEFEDPSQ
YNDTIDKYYQRNHYTVTGNYQNPLTLPRNISSHRFQVDKADSDVISYCKNVDPRATDTKP
IIEDRHFDKSFYWFAMHRKKFGFRYLALCFLALLYTLFGATVFYLIEGSYELERLRMREQ
NMDQLLDRLAQEFSEAVNDPEQSYTHRKMKELIKESYIELQKEEEQYKWSTYYRLENPSH
LKWSFSSSFFFSMNIYTTTGYGMQSLLIVHNNPTPLTGSISAQTTAGQLFTMLYAFCFVP
MTLVILRDLGQMFLVNFTKLYAHGLTLVRRVRGRREIDEDEMIQLPIKFCMGILVAYLLL
CTTFVYLYDALMGPKWDAGLPYFTAFYFSFISLSTIGLGDVMPNNVPYAPPVSILFFIGM
AVTKVVNRATYIAVENGVFGIMTMAETKVDNLLAQKTKNNEHENENEESSDNSSDDGAMD
RRRNELMNSFTVRSIATFMRSNHDVYGGGFGRVQLRRGDLLMNNAHTVAVGTSRRIRPEI
Download sequence
Identical sequences A0A2H2IHN9
281687.CJA15285 CJA15285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]