SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15447 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15447
Domain Number 1 Region: 291-320
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000349
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Weak hits

Sequence:  281687.CJA15447
Domain Number - Region: 342-377
Classification Level Classification E-value
Superfamily Acid proteases 0.00242
Family Retroviral protease (retropepsin) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15447
Sequence length 562
Comment (Caenorhabditis japonica)
Sequence
MKSHLKVWQERSKDDHEGKQKIHETWRKPRRASRSSTSSSEAPSWENRSETKSDTSRRAE
VRDMMDGMRRMMRAQALPEPRMFDGEGDFGEFKRAFLLKYNNVTEGPEEMVAILEDKFLK
GPAKTLFKTLPNRHNRSIKSLFEEFEQKLRKRQGDSRTKALNEFENLRKSPNQKMWEYLI
DVEKWSRKAYPGVDEGNLSQMRTTKLMMAVKDNENLHNLLIMKRLDYSIEDQYENLKDVV
LQQEQEKRQTLKKGHSFLMNEGKMKKDTSWRRSDRHPKQFKEEQKDEMGFKRVEKQSQPN
LRCFRCGGVGHTSRQCTSKPAYAVKEKKAEESEGVGAEVIESVEILGQNRKIVIDSGAVV
SVMSSAVWEKLKKGCPDWEKRVEVLAKPGFTILNASKAEMPVEKQLKLEVGVRGRKAFIR
IGQMNRSCCVYDSVVFGGQFHDLLDAKMDTVSASIDQKNAPELKKLEKEFEIAQKNYDEV
IEKGKNGIPANTFASKKSRANTSLTIAKLRYEKGLFQTSIDQILAMISALNEFIRELNQW
CRRFLRCEPLAELVVLKNNEPS
Download sequence
Identical sequences CJA15447 281687.CJA15447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]