SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15484
Domain Number 1 Region: 178-209
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000356
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  281687.CJA15484
Domain Number - Region: 251-358
Classification Level Classification E-value
Superfamily Acid proteases 0.000102
Family Retroviral protease (retropepsin) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15484
Sequence length 807
Comment (Caenorhabditis japonica)
Sequence
MEVGRLSAEQQVTLLETKYLSGKALKAFRGLREAEKQSVGSILRALANRLRISVEDETRR
AKTRWETLRIAESQSVEDYCLLLDEVARIAYRRLPPEELSSLKTAKLLGAIAGNEALRCM
IDAKLLEYPEKEHYDISRLLAIRHEMSLKEFREKKEVRSQRDGNMVTVNREVRNFSNVLS
NRQGFPKIAVQCFKCGVYGHTARICPTLAEAPVQRNALKEPNLNVESIDIKSSDVQQGKR
VKKGVVRGTKMIEKGKIGSADVDFVIDSGSCISLMSTKTWRWICKINGVEWEKKIKKEKT
DLRTVFTATNEPIKLIEKVSVETSMRTRTRRLTFYVAAVDRETIILGTGAFKAMGVQLKI
DEPSRDVRIVDGVKLDRHGQKIVEIFVEGIIHEERRLCLITPTSKCLTAGVCQVNSEGRS
RIKIANHVNENILFRKGQRIATGELSGFEILNKKPELLKKLNSWFRDIDVTKTYKPTVCE
VRQEVQVVGSHSNGPLEKDGEDAVGNVHSDADSRFGLAHGRKKGRQTAKKNVNKEHEMHT
RSFDERNNEARREQHVQPANRTFMRPRSCLVRNTFGEKYTNQPVDTLLVMAPGVSENAVP
LAFTEKLILKRSQSAEEMLLKQLKKKRYSRMIMIIPFATDDGYVDQWSRLVNVVPGSTKI
LLIPAPTSINDFSLAGAFISLVASVKRSRGELDVISPGDRVMTHKNQRLVDLGDQMNPFD
YWHVINNVIRGRNLVWQPLKDHTFAFVGGLEKDRDVERALDFPDVFSFEVTVRIARRQMQ
KINYFHVTSGVRGNVGGELAGFRQAVR
Download sequence
Identical sequences CJA15484 281687.CJA15484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]