SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15913
Domain Number 1 Region: 467-674
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-39
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 219-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-24
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15913
Sequence length 816
Comment (Caenorhabditis japonica)
Sequence
MYQGPRRANTQLDRDVRRREFSYVDRQMSSKPTHLEEWKSPRSEDSFDLFDPKLASKPRP
LPEAPPKEDPKKQSEVVIQIDEVESPILGVVNEHHDDDDSVFHDNPRAGGLSSSMEANSL
TATRNSSVLDDDVRSQISFIMRERLHSIAKEVHRRTSAIREDLIKETPEDTISVASNVPK
QNEHRPSLMSLIGLQNRPDSPLPANQKRCFGLSVQGTFHPYGRFYMTWLSLVTLCFLYNS
FCIPLRSSYPYQTADNWVYWFIVDYACDVVYLVDMLVIKPRLRFTRGGIQVKVLADTRRH
YLMTRTIKLDILSILPTDLMYFAFGKKPIWRMNRTLKINSFWLLFDMLDNSFSNPYAIRI
ARTLSYMIYIIHCNSCVYYKLSAMQAFGQIAYLENGKWYLNKWVYNNQGNAYIRCFYFTA
AVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLA
LGECKKLGLDTILINRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKV
QLFQDCDRALLRDLVLKLRPVIFLPGDMICKKVGAQKVKCRGILIGDVGKEMYIINQGIL
QVVGGDNNEQVFTELGQGAVFGEISLLAIGGNNRRTASIRAKGYCTLFVLAKEDLNDVIR
YYPQAQALLRRKAAAMLKNDKKSDEKTEKTKQQQELEDRCKINPRQVPKLITLIANMEEM
NANKGVQELRKAIEENPDKPRRQSMYYPWSTLQRDDLDDDDDVWDGTDLSDVGEDESDGD
LEATDPLEDVDIIDGADDEDDWDQPGPSGTQKLHAD
Download sequence
Identical sequences CJA15913 281687.CJA15913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]