SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16155
Domain Number 1 Region: 411-451
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16155
Sequence length 751
Comment (Caenorhabditis japonica)
Sequence
MPIYRFFNRNAYCSACIISQGRHSPGILGKVLVTADLPIQQEKGNLRDREDMETEKENSS
SAATTVVSETDETSRRQDTTGDNINTQTNPIVGNETRAQQDCRNSRSNSATRRVTRSMTA
NAPPRVNVCAMKTNSSVPMFSGTTKENFHTFMRHFTDHLNIMQNPSNREVRNLLLTVLTD
FARDKAEEVLEANPEATYEDICKSLRSQYENQYTNQARLDAIKVCFQYDQEPVQDYYQRI
RAAMRDAQTGTNRQNVLTVALEAFIDGLQPEIRFQVEMRQSSDFEEVFKDAIFAEKALNR
KVKSVRTNETLAATNRQQLPDVYAQAIQQHQAQFRYVHNNPAGEFYDDANSDTGVPGIAA
FAPRREVWHGFPRGNIHYPESVDAFQHNHMFRRNFDHNDMSLNSLRQTKNETSSLGLNRQ
QLAFLNAQCWYCGRIGHNRQDCRTRTRDRFQGMYRTTILDPPHASHRSNTPRNHSHQQPL
DSTENHHQPTIRVIGTNERARTEEQNRYREQYEEQLRINKVQENRIKDMTWRLHAFQMGQ
DSSGYSTPNVNIITPLEKEAKSVAARPQVLTKRSSRRKKKEKNEIKKKIIINQKKKKKKK
LRQYFPQYLFHSIPTCITWQQVRLPAQPPHQRAETKATIPLITRDAPFHFERIRVDPEEK
GGGVSVEPFPGPSLLPGTLIRQSLGVSLRSTPHPRTLVRLSPCVSTRSPPTSTHTRTACR
LAPPRRPCTLARRTVGPFRMTRLPLIHQSLI
Download sequence
Identical sequences CJA16155 281687.CJA16155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]