SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16280
Domain Number 1 Region: 1067-1362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.8e-52
Family Tandem AAA-ATPase domain 0.00016
Further Details:      
 
Domain Number 2 Region: 864-908
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000181
Family Retrovirus zinc finger-like domains 0.0013
Further Details:      
 
Domain Number 3 Region: 816-862
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000361
Family Retrovirus zinc finger-like domains 0.001
Further Details:      
 
Domain Number 4 Region: 916-939
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000366
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16280
Sequence length 1405
Comment (Caenorhabditis japonica)
Sequence
MGIGRELSTAPYVEKPASPAQIPVLSRAPLTLNRESNGARGFAVSDDRWGLNEHVEVCTA
PYVEKPASPAQIPVLSRAPLTLNRESNGARGFAVSDDRWGLNEHVEVCTAPYVEKPASPA
QIPVLSRAPLTLNRESNGARGFAVSDDRWGLNEHVEVCTAPYVEKPASPAQIPVLSRAPL
TLNRESNGARGFAVSDDRWGLNEHVEVCTAPYVEKPASPAQIPVLSRAPLTLNRESNGDL
GFAVQKSEFVSQPQNGQSSGKVSRITNLPTQVDEKPVRQILPPRSERGTSNSTSRKDVGM
EPSVTKYPSLKTSSTGGQPASFGGQLPDNKLTFAKQSSSRFDGQNTRSAMKPTDFGEDAF
GKQDDRNSSSRFDINESNSSLTSLEFGEFPHKSISRKVSEAQKPLVLGREGMHSRNSLRY
DRYDIDTPKNMVSSGSEKSYGAGFGSSKPSGFGGTQTTPGGFGSMTKEPGFGGDRGVTQS
NGFGGSQESSNGFGSRTNETRKYSGFVTEKLYSRFDKVQNSFDEISSRGKESLKHPLAED
EKPSSEFGESQESSKSFGSMSNESFKPSEFGDEEPPSEVARVKGASEFDGAQESYRALGS
VSKESIKPSGFGGDEPPTEVAAVKEAIEFDGAKELSRPLGSVSNESIKPSGFGGDEPPTK
VSEVKEASVFGGSQTPSNALGSISNESIKPSGFGGDEPSTEVVRVKEVSVFGRYQAPSNA
LASRSNESLKSSGFGGDEPDGFSATVKNRPVFGSGVAGESKGFGFSGNSGFGASAGFGAT
SNSGFGSPFGGNKFGSGDNGFSKNEFGDGVGRFGDNQERKSGCFNCGKDGHRKDQCSEPP
KVSTCRNCGEEGHFSRECEKPKVPNGPCRNCGIEGHYSRDCTEPRVPNGPCRNCGQPGHF
AKDCENERVHVEPVGACRRCGEEGHWSSDCPTRARDLQGNILVPYEVQFVPETELFEDAV
DNDSRICFDQKVYASTGSYNIPDYATFDEFKLLPPKLNKNLKRMKINRPTPIQKASFFPI
LSGTDVVACAHTGSGKTLAFLIPFATQLLEDVTSYDGVRDDKPSPGLLIVAPTRELACQT
FDTARQLTYETGLKCGIAYGGYARNANIQHLRSFEQLNILVATMGRLQDFLESGDVSLEK
LRYIVLDEADRMVDANDFGLEVSKIIGPPAERVAQTVLFSASFSENLQRDNLPDFVRKGY
TMLQVDKFGTANEKIDQQFLSVSRSEKRSELCKLIGLDENTYTILPEARIQHEKTLIFVN
TVKFSDSLACFLCNAGVQSIPMHSHQNQEQRDRTLNDFRRGKWMCMVASNVCARGLNISG
LDHVINYDMPDKSGFDEYVNRIGRTARAGFTGFATSFVDLQADREIISSLVDVLAEAGKE
VPEWLADIKENEEAFNDEEDPDEKW
Download sequence
Identical sequences CJA16280 281687.CJA16280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]