SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16529
Domain Number 1 Region: 408-502
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000245
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Domain Number 2 Region: 357-395
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000172
Family Retroviral protease (retropepsin) 0.0092
Further Details:      
 
Weak hits

Sequence:  281687.CJA16529
Domain Number - Region: 585-603
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000727
Family Homeodomain 0.014
Further Details:      
 
Domain Number - Region: 311-348
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00179
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16529
Sequence length 607
Comment (Caenorhabditis japonica)
Sequence
MDSNAMKLFLAQQKEAQQAQQKDAQQAQEQQFKFFKEQQEQLLRTMLAALTTQKDPTGII
NSLNNRIPTFTYAPEDGETFDKWFGRHEDTIKLDGADLDDSAKARFILTKLDRKEAEQFR
NHVLPKTPAEVNFEDTIQMLKKLFNETKSLTRLRYELLSVKFNGYDRKQYTGLVKSRFSA
AQWTKMTEDQAQCLLWIIGLQSNEYLDLRLRALRELELNPSITLSELADRLDQVIALRND
ADFIGGPPTAVHAVNKHAKRQQRYDKGRRHESTKAPTATIPSQSTSSSTPSTPSSSTTSS
SHPCSKCCRIHGRQKCRVSKYTVCRNCNKAGHLARACKQKKAHVSNAIFIAHTSAAKHNR
IYTTVHINGKPIKMQLDTGAEATLLNVKDWERKGAVSCHLYCSHSAAKHNRIYTTVHING
KPIKMQLDTGAEATLLNVKDWERLNRPKLSPSSANLRTTTNAQIKVRGQLNCKFVLNGHH
GSGRCLVTDTVSLLGMDWIAQDNHLYQLLQGRGRYSEARAVAHTKPKDRHPAHAAIQKVL
HKPQRSIEQGLPQTTRTPSSTPSPSWRNKTINNCSGRCYDESRRKNKYNVKIWFQNRRIR
MRRDANK
Download sequence
Identical sequences 281687.CJA16529 CJA16529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]