SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16641 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16641
Domain Number 1 Region: 329-421
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000123
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Domain Number 2 Region: 268-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16641
Sequence length 433
Comment (Caenorhabditis japonica)
Sequence
MDSTALKLFLTQQQEAHKEQLVFLQQQQEKLLETILKKIGTQTDHTSILNSLNGRIATFK
YNSEDGETFDRWFGRYEDVIKVDGAQLDDASKTRLLVTKLDKHEAEQFRNHILPKMPAEV
NFEDTVAMLKKLFNETKSLTRLRYELLSVKFDGNDRKIYTGLVKSRFSVAQWSIMTEDQA
QCLLWIMGLQSHEHAELRARALRELEQDSRITLTELTDRLDQVIALRNDSDFMGGPASSV
NAVNYNKAKQQPQSSRKPSQAHSKSNNSCQPPKTPCYKCGQMHWARDCKLSSNTVCRNCN
KNGHLAKVCKSKRSTNNAIFIAQSSVQNRNRIYYNVEIEGKQIKMQLDTGAEVTLMNSKD
WMRLNKPKLSHSTINLRTANNEPIKVKGQFKCNFNLNGHHGSGLCHVTDTASLLGLDWIA
QDTTLYQHLIQAS
Download sequence
Identical sequences 281687.CJA16641 CJA16641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]