SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16773
Domain Number 1 Region: 236-327
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000563
Family Retroviral protease (retropepsin) 0.0097
Further Details:      
 
Domain Number 2 Region: 167-211
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000314
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16773
Sequence length 1131
Comment (Caenorhabditis japonica)
Sequence
MFLWDMPTRILKRICPRKHTEVEFDETVKTLEQMFDIKKSLFSHRFACINIARDDETPVE
YTTKVNSMCESAMLQDIDAEGWKVFFWLKGLDASRDKSARTYFIRYVEQKWEKKESVNVN
DLCEEWKKLLRQNSVVQEMEQVDKAVRALHTKKDFNRNHKKVWNREQSSGKVDECWNCGK
VGHRKPDCRQRLTKCLKCQKTGHLSKYCKSKGSKKAQSMVVIESAAAEDVEVNAVRQYVM
VEVNDQLIEFQLDTGSDITLISRKDWMKVGEPELEKCPMKVKSASGNEVKLLGRAKVDFM
LKGSAASAFVHVREQGNLLGLDWISKSSEMTYHMNMMINELKSSDTESIGKELKEKFPEV
FLEGLGTCTKEKAVLTVKDKSSPVFIGKRPVPYGALETVEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTTMFDIFEVPLPQETSTPMSVTTPTFATPSREQQQQGLS
MQQGHQSRAQARMPSSAQFSQRSQQHQSPGVVPVRRGNRVRKPVNRYDPSN
Download sequence
Identical sequences CJA16773 281687.CJA16773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]