SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16947
Domain Number 1 Region: 74-105
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  281687.CJA16947
Domain Number - Region: 148-254
Classification Level Classification E-value
Superfamily Acid proteases 0.000105
Family Retroviral protease (retropepsin) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16947
Sequence length 673
Comment (Caenorhabditis japonica)
Sequence
MISFLKPLLEKALRCMIDAKLLESPEKEHYDISRLLAIRHEMSLKEFREKREVRSERDGK
MVTLNKEVRHFSNVLPNCQSFPNAAVQCFKCGGYGHTARICPTLAEAPVQRNALKEPNLK
VESIDIKGLDLQQRKRVKKDVARGTKMIEQGKIGSADVDFVIDSGSCISLMSMKTWRRIL
KINGVEWKKEVRKEKTDLRTVFTAANEPIKLIEKVSVETAMRTRTRRLTFYVAAVDRETI
ILGTEGFKALGIQLKIDEPPRDVRIVDEVKLDRHGQKIVAIVVEGIIHKERRLCLITPTS
RCLTAGVCQVNSEGKARINIANHISEIIFLRKGQKIATGELNGFEVLNKRPELLGKLNKW
LRDTEDTKPHKPTVCEVRREVQVGGRRPNGPLEKDGEDAVGNVHSDADSRVGLAHERKAA
KKNVSKEHAMRTRSFDERNNEAKYEHHVRPANRTFTRPRSCLVRNTFDEKYTNQPVDTLL
VMAPGVSENVTLAFTEKLILKRSQSAEEILLMQFKKKRYSRMIMSIPFATDNGYVDQWSR
LIKVVPGSTKILLIPAPTSVDDFSLAGAFISLVASVKRSRGELDVISPGDRMMAHKNQRL
VDLGDQMNSFDYWHVVNNVIRGRNLVWQPLKVSVVDMGHTRRRSHGLPARQAVQSRSTEL
APLLLARTLVFSN
Download sequence
Identical sequences 281687.CJA16947 CJA16947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]