SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17003
Domain Number 1 Region: 84-116,174-234
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-23
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 308-391
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-17
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17003
Sequence length 739
Comment (Caenorhabditis japonica)
Sequence
MPVLLRAVGFGRSSNTRNNLRPGSTASGDRLRRPSQISSSAQSSATRQSVADKDKLAQSR
IHENNEPEESEKVTWGQRFHRIYKEYHIKYLFPLMFIMFYMLIGAIIFYFLESGAAETVA
TDEDYKYKRERRLLLLRMEELVQDTATRRRGYRKKALEEAIDNYEQKLEFSVKNESQWTF
MSAMYFAGTLFTTIGYGDIACVTTSGRIATVIYSCVGIPFMLITLNDLGKFLYNNINGCV
KGFEDFTTYLGAFRLCRRSNANFPKGDELLTLEAGTTDVHNDVSSLASQLGSERNESDYE
DIEDEEERAMPRMSVKVALGITVGWIFFCSALFKLWEDWTYGESCYFMFISLSTIGLGDV
SVKRRDMMVLCFVFVIVGLSLVSMTINVIQVALEDFYVNLIMKLIIDYQEKLAAAGVGSK
KIVFFCFFQVFFGRNKTFCFFYLIMRARQTIYYCIFDREPWAKSFLFFFILEELVQKQIE
IEEAAAENAVLFVAHDANTQTDILLQEEKSHQTDEKIFDEVGTQTELAPTDNLECETQTE
SIQNSIAETQTFNPDIRDSDTMTQPVIVNESDSQTEYILTKEEELQTYIDTNDVETFTEI
ETKNVRIQTPQPVIEQKCVQTEDLEDRKSPSKMSSAKKRLRRAFAGKSKPTRSSLDHPVM
SDWKDVEESETAQDEEEEEIGSVESLHWDPVDGMHAEKQLPVKKLKALFDSPKGQRKLER
KYSSFNKKRENSRSRNKSE
Download sequence
Identical sequences 281687.CJA17003 CJA17003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]