SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17013
Domain Number 1 Region: 612-631,674-788,920-1034
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.85e-36
Family Phosphate binding protein-like 0.0000756
Further Details:      
 
Domain Number 2 Region: 107-224,444-608
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000204
Family L-arabinose binding protein-like 0.014
Further Details:      
 
Weak hits

Sequence:  281687.CJA17013
Domain Number - Region: 775-809,836-895
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000406
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17013
Sequence length 1152
Comment (Caenorhabditis japonica)
Sequence
MVWFLALSGVYAIDYKVSVLIFAEPHDSFDELQVAVTTAFVEVFGNTTYRLGNDSIQAVF
VDAKSGQNRLELTQDIVCGQMLNSSLASVIFSPSPTSSAKFLDLVTSSAYTLSFYKLPVV
GVMVRDAEFSKKNIYPTFVRPTAALSDEAFVFLHILLRLQYRQVVVLSVKRDPNADEFVA
EFEQRRAEFKIIDGVVHRQSPGRPRTTSRAMDRNILRSCREDPRRTSTDIQVFVTSPNEP
VPSRRTIRRRLQVAGLYGRRPVKKSYAPQYQCPTVKHGGGSEMVWGCFSDTSMGPLKRIV
GTMDDMCTKTSWRTQSNLGRSWLFQQDNDPKHTSGHVANWFRVDLLEWPSQSPDLNPIEH
MWEELEQRLKGFRASNANQIFAQLEAAWKSIPMTVVQTLLDSMPRRCQAVIDAKGYPTKY
IEVELNANLNDTLAENFEEVTSNIIVLFAKKDDATRIFANAGDLTGKGKVWIVSESAGEA
HNVPNGSIGCRLGQTALSVLRDSFSILKFAMEKVWRESETDILPPVECDRDSLDHEWNTA
QAPALLSEICGVSTARVNFNDNCERIGVEYDVINFHMERRHVGNMIGDTLRLDEDSIEWA
GGSKPLEISLPKHLRVVTVADPPFVYITPVTMPSQCAELGSTQVEWSVFDRILVPGPWYS
CPKKISVNTTEYFCCAGLAIDLLSNLSLPEANNSIDTSFTFSLHLNESYGVVQAAETTGY
TIGGVIGELDGDTADMAIGGITINPERERIVDFSEPWLYHGIRILEKNIPRDSPMQSFLQ
PLQSSLWSALFVSVLLVGLAIYCLDFKSPFERFYQSDHGFDQEDLRPEFELWVGKDEDDN
VNFGEAMWFVWGVLLNSGVSEKTPRSCSARVLGIVWCGFCMIMVASYTANLAAFLVLDQP
EKGLTGVTDPRLRNPSANFSFGTVLNSNVYQYFKRHVELSSMFRKMEPHNVHRASEAVHS
LLNGTLDAFIWDSTRLDFEAARHCELRTRGSLFGRSAYGIGLQKNSPWTPHITSAILRMS
ESGVMENLDQKWIDRGGPNCVVEAHKSPARLGLVNMKREKHDFQDIFILVSSGVALGMFL
SFVEVSYGRWLADKGLGHLNFGLIFEKEWIVFPGAVAFWCKDISENGTTCPKKFFFFFNF
LRMKKKFFFLIF
Download sequence
Identical sequences CJA17013 281687.CJA17013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]