SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17034
Domain Number 1 Region: 179-213
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000113
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 
Weak hits

Sequence:  281687.CJA17034
Domain Number - Region: 48-111
Classification Level Classification E-value
Superfamily L30e-like 0.0471
Family L30e/L7ae ribosomal proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17034
Sequence length 251
Comment (Caenorhabditis japonica)
Sequence
MAEQDERDRLLSLLGQDVMERMLPKVKEMLANKEEEKAPEIGQKGLMVQAELNAKMINML
RAAMDEEDPKKGIKDVIETLKQRNTELQLLDRNPEALKTVERMKAVAALTGTDADSQKLI
ALAQVLTDSSGRSARPTGSSAQWFRAPGSSYANGGVRSQPSSNFRRFGAQKRSGSTSSTS
MERGYGKIGGTGPECYACHSIGHFSRNCPQRRYSERGEAIRKVIFLGIGDGRPVDFEHYS
KRLRHSDSRKF
Download sequence
Identical sequences 281687.CJA17034 CJA17034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]