SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17229
Domain Number 1 Region: 948-1381
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.11e-21
Family Reverse transcriptase 0.041
Further Details:      
 
Weak hits

Sequence:  281687.CJA17229
Domain Number - Region: 677-742
Classification Level Classification E-value
Superfamily Acid proteases 0.000285
Family Retroviral protease (retropepsin) 0.031
Further Details:      
 
Domain Number - Region: 592-628
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0283
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17229
Sequence length 1775
Comment (Caenorhabditis japonica)
Sequence
MQSSSNHPQSGDTRSVPQKVAPVKSYVSRLANQLKETLLQSESLLKLGSSTSAVRCDAIC
GIINTIDAHLQHVADLPVTISDRLHLLNLTDTEYAEGFEAVMLHCETTEIQNLHGQLTRA
AQQLREELTLITNVEGTASPPARTKKGPTTGPRLESSPEPSPPLVDAETPADAQEIALVN
ISNETESPQTEVTETELIALRRDLARAKVLLHAEQASHRSTRQSLSEANQRSTELSQVMV
EYDEQLRTVRELSDPAPLNQNVPAQVPVPLSNLTHGDLARHRLSQNIGALTGFTSQPRLE
PVSPRSPIPQSNLCEENKQTRQPMFSSPDFATGRSPILFSPRAGNYESNPFKDPLRMIPT
FKGETSTFREFEEQLEFLAEGQSWSSDIKFAVLRSKLAEPASSLLSHLPNKQDAYFKTMA
NLRRAYGESNNVAALIREFKAAKISHNNMSALIVDSIKIEGIIERLARSQYTFSQSDTLD
LIRKLPFEPIGRELLEKYESNPDLGFAFVLQHIHNRAKSLRFCEEQQRKEIMKQPYPTVS
EILTIDAEADEEINIFHGQKREGQRKSTFKCDLCGGPHSRFNCQLSAREQRKSLNDQNRC
RLCMTTGHNNTDCQKPWRCRHCGDTHHTNNYAFANAAVNRESKNNLAQTDAVIMNVQKYE
RDDDEYRLPFVAIPTPSGPPVIALVDTGATCSLFSEGAAQSRNLTKVSCETMRYEGIAGQ
TIVDSPIFLIPIEESGKTRSIFVRGFPNLNTTFRAPVFRAEDITHLDSIGIDAKKLMELS
HLNGQKIDMILGQDLLPELSSSKHRLPSGRIVEKTKYGAITYPAPSQKCFLAPENSAQLS
LKAIPLELLNTVSTKSFKSSDEAMEAAYHRHHDLEILGITPPEQGDTKKLRTDEFIQQVK
EQVTVADGHLAVPLLFNGREKELASNFRLAICRLKSLWEKLKGREKLLTDYSKVMSDQLA
AGYIERVPDTMSRPSSPVYYIPHQEVIKLESLTTKLRVVLDASSHMKGEYSLNDCLHTGP
NILQSILGILLIVRARLSQYLITADIEKAFHQVRLQNKFRDCVRCIWFKDPTKGTSEGNI
EIFRFTRIPFGVNCSPFLLAVAVMFHLEQNPNPLNERILRDIYVDNVILSSNDRQELLKL
YESSKSIFDKAEMNLREFSVNESETLSAIPEKDRAQGSLGKLLGYQWDRDTDTLFATVAI
PPVGKLTKRLIAGFLGETFDPLGIFSPIIVAVKALLQDLWTLGISWDEQIPNSMIPAWEK
IASGFTLPKVSFPRQVTSRYDYERVQLCIFADANKENFACTAYIRYEYEDREPKSTLIFA
KTRQKSRNTNASIPRMELMAIEIAVNAAATLVKELHLKELSGVRIFSDSMIALYWVLKND
KCHSFVNNRVANIHNVMSELKEWDPTFHHVPTDLNPADIASRGCTLEALMCGTLWFDGPE
FLKQPEAKWPNRLCGNLNYEDFELAAIMKEVVQPQHAKRIKNSCIPLSHYQKLPKASGSE
VLLHMQKKSTPILEKSEIRDDKWSSFIPYNKFKSFNRLTTTISSVLRFLVKAFPGKNSTS
DTMKKFVASYNTAKTSAEAELTEAVRQRHIARKLVIADHYRDATEVRRIPFHEQNRCSLY
PDGSYHHRRAICRAPLPLETTNPTVIISKHPLASMLARDVHLANSHCSEATIVRTLRQHY
HIPRDRRLARSITTKCVNCKKQKARPDAYPYSKALPECRTKPTSPFQHVGLEYFGPLGYT
AVPREVQFVPARIVCGNKKRSEAGTCFKLVLFHYL
Download sequence
Identical sequences CJA17229 281687.CJA17229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]