SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17375
Domain Number 1 Region: 426-453
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000016
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Weak hits

Sequence:  281687.CJA17375
Domain Number - Region: 470-514
Classification Level Classification E-value
Superfamily Acid proteases 0.000788
Family Retroviral protease (retropepsin) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17375
Sequence length 650
Comment (Caenorhabditis japonica)
Sequence
MNVMRALDVENADDLERSFVEMRSTNECAEKWRNNYEMLKKELLDSQKKWAVEKENLKSA
VRELSKTAGHLRRRAEKAEMTATTAKQGQWIRKNADGSSNESETSEELFSMREKIQASWK
ARRSTASRISSWQATQKEDKRQSESTREQRSAAGAEKDEKWPYGKWRTSRRQHELAEECA
EEDSLPEGWRLENPRKDIVKETIVSMAKMMRSSALPEPKVFDGAGNFGEFKRTFLMKFRD
VIEKDEDLVAILEEKYLKGAARELFRSLKNRYRSPIKLIFAEFEERLRRRQGDSQAHALA
EFDELQKEVNQRMWEYLPEIEKWSQRAYPNIDSETLSQMRVTKLMKAVKEDQNLQNLLIM
KRRETPLGDQYETLKDIHAVWRDADQRSRTLKRTEEQIETEWKSGEEDMGQGQEQRGLRS
LSESSQGTEESSKRRKCFRCGGAGHIAKECTSKPLYNVVREAESVGTEMLETCEVLGQKR
KVIIDSGAVVSVISSEAWKRLKRGCKGWRYKCEMMGKPKFTLVNAAKLSMAEVICRKSKS
RTARREKRRFWSVNDPVVAMMLKKTERAKDNGMILKPDESRKRSEETHGKMALGWTAGAC
NGRRKRGGQSLTGYDLWQTTSGGKVGGVDKRGRMQCIKIKAPPSHREEII
Download sequence
Identical sequences 281687.CJA17375 CJA17375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]